KEGG   Homo sapiens (human): 6356Help
Entry
6356              CDS       T01001                                 

Gene name
CCL11, SCYA11
Definition
(RefSeq) C-C motif chemokine ligand 11
  KO
K16597  C-C motif chemokine 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa05310  Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6356 (CCL11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6356 (CCL11)
   04062 Chemokine signaling pathway
    6356 (CCL11)
 09160 Human Diseases
  09163 Immune diseases
   05310 Asthma
    6356 (CCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6356 (CCL11)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6356 (CCL11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 Tetraspanin
Motif
Other DBs
NCBI-GeneID: 6356
NCBI-ProteinID: NP_002977
OMIM: 601156
HGNC: 10610
Ensembl: ENSG00000172156
Vega: OTTHUMG00000132884
Pharos: P51671(Tbio)
UniProt: P51671 Q6I9T4
Structure
PDB: 

Position
17q12
AA seq 97 aa AA seqDB search
MKVSAALLWLLLIAAAFSPQGLAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQK
AVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtctccgcagcacttctgtggctgctgctcatagcagctgccttcagcccccag
gggctcgctgggccagcttctgtcccaaccacctgctgctttaacctggccaataggaag
ataccccttcagcgactagagagctacaggagaatcaccagtggcaaatgtccccagaaa
gctgtgatcttcaagaccaaactggccaaggatatctgtgccgaccccaagaagaagtgg
gtgcaggattccatgaagtatctggaccaaaaatctccaactccaaagccataa

DBGET integrated database retrieval system