KEGG   Homo sapiens (human): 6357Help
Entry
6357              CDS       T01001                                 

Gene name
CCL13, CKb10, MCP-4, NCC-1, NCC1, SCYA13, SCYL1
Definition
(RefSeq) C-C motif chemokine ligand 13
  KO
K16595  C-C motif chemokine 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6357 (CCL13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6357 (CCL13)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6357 (CCL13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6357 (CCL13)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6357 (CCL13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6357 (CCL13)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Chemokines
   6357 (CCL13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8 ATXN-1_C
Motif
Other DBs
NCBI-GeneID: 6357
NCBI-ProteinID: NP_005399
OMIM: 601391
HGNC: 10611
Ensembl: ENSG00000181374
Vega: OTTHUMG00000132890
Pharos: Q99616(Tbio)
UniProt: Q99616
Structure
PDB: 

Position
17q12
AA seq 98 aa AA seqDB search
MKVSAVLLCLLLMTAAFNPQGLAQPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQ
KAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtctctgcagtgcttctgtgcctgctgctcatgacagcagctttcaacccccag
ggacttgctcagccagatgcactcaacgtcccatctacttgctgcttcacatttagcagt
aagaagatctccttgcagaggctgaagagctatgtgatcaccaccagcaggtgtccccag
aaggctgtcatcttcagaaccaaactgggcaaggagatctgtgctgacccaaaggagaag
tgggtccagaattatatgaaacacctgggccggaaagctcacaccctgaagacttga

DBGET integrated database retrieval system