KEGG   Homo sapiens (human): 6358Help
Entry
6358              CDS       T01001                                 

Gene name
CCL14, CC-1, CC-3, CKB1, HCC-1, HCC-1(1-74), HCC-1/HCC-3, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14
Definition
(RefSeq) C-C motif chemokine ligand 14
  KO
K21092  C-C motif chemokine 14
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6358 (CCL14)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6358 (CCL14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6358 (CCL14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6358 (CCL14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6358
NCBI-ProteinID: NP_116739
OMIM: 601392
HGNC: 10612
Ensembl: ENSG00000276409
Vega: OTTHUMG00000188403
Pharos: Q16627(Tbio)
UniProt: Q16627
Structure
PDB: 

Position
17q12
AA seq 93 aa AA seqDB search
MKISVAAIPFFLLITIALGTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCS
KPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgaagatctccgtggctgccattcccttcttcctcctcatcaccatcgccctagggacc
aagactgaatcctcctcacggggaccttaccacccctcagagtgctgcttcacctacact
acctacaagatcccgcgtcagcggattatggattactatgagaccaacagccagtgctcc
aagcccggaattgtcttcatcaccaaaaggggccattccgtctgtaccaaccccagtgac
aagtgggtccaggactatatcaaggacatgaaggagaactga

DBGET integrated database retrieval system