KEGG   Homo sapiens (human): 6364Help
Entry
6364              CDS       T01001                                 

Gene name
CCL20, CKb4, Exodus, LARC, MIP-3-alpha, MIP-3a, MIP3A, SCYA20, ST38
Definition
(RefSeq) C-C motif chemokine ligand 20
  KO
K14625  C-C motif chemokine 20
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6364 (CCL20)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6364 (CCL20)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6364 (CCL20)
   04062 Chemokine signaling pathway
    6364 (CCL20)
 09160 Human Diseases
  09163 Immune diseases
   05323 Rheumatoid arthritis
    6364 (CCL20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6364 (CCL20)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6364 (CCL20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6364
NCBI-ProteinID: NP_004582
OMIM: 601960
HGNC: 10619
Ensembl: ENSG00000115009
Vega: OTTHUMG00000133189
Pharos: P78556(Tbio)
UniProt: P78556
Structure
PDB: 

Position
2q36.3
AA seq 96 aa AA seqDB search
MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDI
NAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtgctgtaccaagagtttgctcctggctgctttgatgtcagtgctgctactccacctc
tgcggcgaatcagaagcagcaagcaactttgactgctgtcttggatacacagaccgtatt
cttcatcctaaatttattgtgggcttcacacggcagctggccaatgaaggctgtgacatc
aatgctatcatctttcacacaaagaaaaagttgtctgtgtgcgcaaatccaaaacagact
tgggtgaaatatattgtgcgtctcctcagtaaaaaagtcaagaacatgtaa

DBGET integrated database retrieval system