KEGG   Homo sapiens (human): 6366Help
Entry
6366              CDS       T01001                                 

Gene name
CCL21, 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4
Definition
(RefSeq) C-C motif chemokine ligand 21
  KO
K16062  C-C motif chemokine 21
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    6366 (CCL21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6366 (CCL21)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6366 (CCL21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6366 (CCL21)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6366 (CCL21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6366
NCBI-ProteinID: NP_002980
OMIM: 602737
HGNC: 10620
Ensembl: ENSG00000137077
Vega: OTTHUMG00000019838
Pharos: O00585(Tbio)
UniProt: O00585
Structure
PDB: 

Position
9p13.3
AA seq 134 aa AA seqDB search
MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIP
AILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSK
GCKRTERSQTPKGP
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtcactggctctgagcctccttatcctggttctggcctttggcatccccagg
acccaaggcagtgatggaggggctcaggactgttgcctcaagtacagccaaaggaagatt
cccgccaaggttgtccgcagctaccggaagcaggaaccaagcttaggctgctccatccca
gctatcctgttcttgccccgcaagcgctctcaggcagagctatgtgcagacccaaaggag
ctctgggtgcagcagctgatgcagcatctggacaagacaccatccccacagaaaccagcc
cagggctgcaggaaggacaggggggcctccaagactggcaagaaaggaaagggctccaaa
ggctgcaagaggactgagcggtcacagacccctaaagggccatag

DBGET integrated database retrieval system