KEGG   Homo sapiens (human): 6368
Entry
6368              CDS       T01001                                 

Gene name
CCL23, CK-BETA-8, CKb8, Ckb-8, Ckb-8-1, MIP-3, MIP3, MPIF-1, SCYA23, hmrp-2a
Definition
(RefSeq) C-C motif chemokine ligand 23
  KO
K05511  C-C motif chemokine 15/23
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01166  CCL3/5/7/8/13/14/15/16/23 to CCR1 signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6368 (CCL23)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6368 (CCL23)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6368 (CCL23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6368 (CCL23)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6368 (CCL23)
SSDB
Motif
Pfam: IL8 FAD_binding_2
Other DBs
NCBI-GeneID: 6368
NCBI-ProteinID: NP_665905
OMIM: 602494
HGNC: 10622
Ensembl: ENSG00000274736
Vega: OTTHUMG00000188409
Pharos: P55773(Tbio)
UniProt: P55773
Structure
PDB: 
1G91

Position
17q12
AA seq 120 aa
MKVSVAALSCLMLVTALGSQARVTKDAETEFMMSKLPLENPVLLDRFHATSADCCISYTP
RSIPCSLLESYFETNSECSKPGVIFLTKKGRRFCANPSDKQVQVCMRMLKLDTRIKTRKN
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctcctgcctcatgcttgttactgcccttggatcccag
gcccgggtcacaaaagatgcagagacagagttcatgatgtcaaagcttccattggaaaat
ccagtacttctggacagattccatgctactagtgctgactgctgcatctcctacacccca
cgaagcatcccgtgttcactcctggagagttactttgaaacgaacagcgagtgctccaag
ccgggtgtcatcttcctcaccaagaaggggcgacgtttctgtgccaaccccagtgataag
caagttcaggtttgcatgagaatgctgaagctggacacacggatcaagaccaggaagaat
tga

DBGET integrated database retrieval system