KEGG   Homo sapiens (human): 637Help
Entry
637               CDS       T01001                                 

Gene name
BID, FP497
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04071  Sphingolipid signaling pathway
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05416  Viral myocarditis
Network
nt06131  Apoptosis (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06231  Apoptosis
nt06263  Hepatocellular carcinoma
  Element
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
N00425  HCMV UL36 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00449  HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways
N00477  EBV BHRF1 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00526  HCV NS3 to crosstalk between extrinsic and intrinsic apoptotic pathways
N00527  HCV Core to crosstalk between extrinsic and intrinsic apoptotic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    637 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    637 (BID)
   04215 Apoptosis - multiple species
    637 (BID)
   04217 Necroptosis
    637 (BID)
   04115 p53 signaling pathway
    637 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    637 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    637 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    637 (BID)
   05014 Amyotrophic lateral sclerosis (ALS)
    637 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    637 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    637 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    637 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    637 (BID)
   05162 Measles
    637 (BID)
   05164 Influenza A
    637 (BID)
   05161 Hepatitis B
    637 (BID)
   05160 Hepatitis C
    637 (BID)
   05168 Herpes simplex virus 1 infection
    637 (BID)
   05163 Human cytomegalovirus infection
    637 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    637 (BID)
   05169 Epstein-Barr virus infection
    637 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    637 (BID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BID Bcl-2 CRM1_C
Motif
Other DBs
NCBI-GeneID: 637
NCBI-ProteinID: NP_001187
OMIM: 601997
HGNC: 1050
Ensembl: ENSG00000015475
Vega: OTTHUMG00000150087
Pharos: P55957(Tbio)
UniProt: P55957 A8ASI8 B3KT21
Structure
PDB: 

Position
22q11.21
AA seq 195 aa AA seqDB search
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ
NLRTYVRSLARNGMD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggactgtgaggtcaacaacggttccagcctcagggatgagtgcatcacaaacctactg
gtgtttggcttcctccaaagctgttctgacaacagcttccgcagagagctggacgcactg
ggccacgagctgccagtgctggctccccagtgggagggctacgatgagctgcagactgat
ggcaaccgcagcagccactcccgcttgggaagaatagaggcagattctgaaagtcaagaa
gacatcatccggaatattgccaggcacctcgcccaggtcggggacagcatggaccgtagc
atccctccgggcctggtgaacggcctggccctgcagctcaggaacaccagccggtcggag
gaggaccggaacagggacctggccactgccctggagcagctgctgcaggcctaccctaga
gacatggagaaggagaagaccatgctggtgctggccctgctgctggccaagaaggtggcc
agtcacacgccgtccttgctccgtgatgtctttcacacaacagtgaattttattaaccag
aacctacgcacctacgtgaggagcttagccagaaatgggatggactga

DBGET integrated database retrieval system