KEGG   Homo sapiens (human): 637Help
Entry
637               CDS       T01001                                 

Gene name
BID, FP497
Definition
(RefSeq) BH3 interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04071  Sphingolipid signaling pathway
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05152  Tuberculosis
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05416  Viral myocarditis
Network
N00146  Crosstalk between extrinsic and intrinsic apoptotic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    637 (BID)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    637 (BID)
   04215 Apoptosis - multiple species
    637 (BID)
   04217 Necroptosis
    637 (BID)
   04115 p53 signaling pathway
    637 (BID)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    637 (BID)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    637 (BID)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    637 (BID)
   05014 Amyotrophic lateral sclerosis (ALS)
    637 (BID)
  Cardiovascular diseases
   05416 Viral myocarditis
    637 (BID)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    637 (BID)
  Infectious diseases
   05152 Tuberculosis
    637 (BID)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    637 (BID)
  Drug resistance
   01524 Platinum drug resistance
    637 (BID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BID Bcl-2 CRM1_C
Motif
Other DBs
NCBI-GeneID: 637
NCBI-ProteinID: NP_001187
OMIM: 601997
HGNC: 1050
Ensembl: ENSG00000015475
Vega: OTTHUMG00000150087
Pharos: P55957(Tbio)
UniProt: P55957 A8ASI8 B3KT21
Structure
PDB: 

Position
22q11.21
AA seq 195 aa AA seqDB search
MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTD
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ
NLRTYVRSLARNGMD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggactgtgaggtcaacaacggttccagcctcagggatgagtgcatcacaaacctactg
gtgtttggcttcctccaaagctgttctgacaacagcttccgcagagagctggacgcactg
ggccacgagctgccagtgctggctccccagtgggagggctacgatgagctgcagactgat
ggcaaccgcagcagccactcccgcttgggaagaatagaggcagattctgaaagtcaagaa
gacatcatccggaatattgccaggcacctcgcccaggtcggggacagcatggaccgtagc
atccctccgggcctggtgaacggcctggccctgcagctcaggaacaccagccggtcggag
gaggaccggaacagggacctggccactgccctggagcagctgctgcaggcctaccctaga
gacatggagaaggagaagaccatgctggtgctggccctgctgctggccaagaaggtggcc
agtcacacgccgtccttgctccgtgatgtctttcacacaacagtgaattttattaaccag
aacctacgcacctacgtgaggagcttagccagaaatgggatggactga

DBGET integrated database retrieval system