KEGG   Homo sapiens (human): 6370
Entry
6370              CDS       T01001                                 

Symbol
CCL25, Ck_beta-15, Ckb15, SCYA25, TECK
Name
(RefSeq) C-C motif chemokine ligand 25
  KO
K13072  C-C motif chemokine 25
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01221  CCL25 to CCR9/11 signaling
N01222  HSV1 SgG1 to CCR signaling
N01223  HSV2 SgG2 to CCR signaling
N01224  VAV CrmB to CCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6370 (CCL25)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6370 (CCL25)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    6370 (CCL25)
   04062 Chemokine signaling pathway
    6370 (CCL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6370 (CCL25)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6370 (CCL25)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6370
NCBI-ProteinID: NP_005615
OMIM: 602565
HGNC: 10624
Ensembl: ENSG00000131142
Vega: OTTHUMG00000141287
Pharos: O15444(Tbio)
UniProt: O15444
Position
19p13.2
AA seq 150 aa
MNLWLLACLVAGFLGAWAPAVHTQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNL
PAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSG
NSKLSSSKFSNPISSSKRNVSLLISANSGL
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaacctgtggctcctggcctgcctggtggccggcttcctgggagcctgggcccccgct
gtccacacccaaggtgtctttgaggactgctgcctggcctaccactaccccattgggtgg
gctgtgctccggcgcgcctggacttaccggatccaggaggtgagcgggagctgcaatctg
cctgctgcgatattctacctccccaagagacacaggaaggtgtgtgggaaccccaaaagc
agggaggtgcagagagccatgaagctcctggatgctcgaaataaggtttttgcaaagctc
caccacaacacgcagaccttccaagcaggccctcatgctgtaaagaagttgagttctgga
aactccaagttatcatcgtccaagtttagcaatcccatcagcagcagtaagaggaatgtc
tccctcctgatatcagctaattcaggactgtga

DBGET integrated database retrieval system