KEGG   Homo sapiens (human): 6374Help
Entry
6374              CDS       T01001                                 

Gene name
CXCL5, ENA-78, SCYB5
Definition
(RefSeq) C-X-C motif chemokine ligand 5
  KO
K05506  C-X-C motif chemokine 5/6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05133  Pertussis
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6374 (CXCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6374 (CXCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6374 (CXCL5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    6374 (CXCL5)
   04062 Chemokine signaling pathway
    6374 (CXCL5)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6374 (CXCL5)
  09171 Infectious disease: bacterial
   05133 Pertussis
    6374 (CXCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6374 (CXCL5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6374 (CXCL5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6374
NCBI-ProteinID: NP_002985
OMIM: 600324
HGNC: 10642
Ensembl: ENSG00000163735
Vega: OTTHUMG00000160871
Pharos: P42830(Tbio)
UniProt: P42830 Q6I9S7
Structure
PDB: 

Position
4q13.3
AA seq 114 aa AA seqDB search
MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHP
KMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcctgtccagccgcgcggcccgtgtccccggtccttcgagctccttgtgcgcg
ctgttggtgctgctgctgctgctgacgcagccagggcccatcgccagcgctggtcctgcc
gctgctgtgttgagagagctgcgttgcgtttgtttacagaccacgcaaggagttcatccc
aaaatgatcagtaatctgcaagtgttcgccataggcccacagtgctccaaggtggaagtg
gtagcctccctgaagaacgggaaggaaatttgtcttgatccagaagccccttttctaaag
aaagtcatccagaaaattttggacggtggaaacaaggaaaactga

DBGET integrated database retrieval system