KEGG   Homo sapiens (human): 6376Help
Entry
6376              CDS       T01001                                 

Gene name
CX3CL1, ABCD-3, C3Xkine, CXC3, CXC3C, NTN, NTT, SCYD1, fractalkine, neurotactin
Definition
(RefSeq) C-X3-C motif chemokine ligand 1
  KO
K05508  C-X3-C motif chemokine 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04668  TNF signaling pathway
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Drug target
Quetmolimab: D11498
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6376 (CX3CL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6376 (CX3CL1)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6376 (CX3CL1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    6376 (CX3CL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    6376 (CX3CL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6376 (CX3CL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6376 (CX3CL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 6376
NCBI-ProteinID: NP_002987
OMIM: 601880
HGNC: 10647
Ensembl: ENSG00000006210
Vega: OTTHUMG00000133469
Pharos: P78423(Tbio)
UniProt: P78423 A0N0N7
Structure
PDB: 

Position
16q21
AA seq 397 aa AA seqDB search
MAPISLSWLLRLATFCHLTVLLAGQHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGK
RAIILETRQHRLFCADPKEQWVKDAMQHLDRQAAALTRNGGTFEKQIGEVKPRTTPAAGG
MDESVVLEPEATGESSSLEPTPSSQEAQRALGTSPELPTGVTGSSGTRLPPTPKAQDGGP
VGTELFRVPPVSTAATWQSSAPHQPGPSLWAEAKTSEAPSTQDPSTQASTASSPAPEENA
PSEGQRVWGQGQSPRPENSLEREEMGPVPAHTDAFQDWGPGSMAHVSVVPVSSEGTPSRE
PVASGSWTPKAEEPIHATMDPQRLGVLITPVPDAQAATRRQAVGLLAFLGLLFCLGVAMF
TYQSLQGCPRKMAGEMAEGLRYIPRSCGSNSYVLVPV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctccgatatctctgtcgtggctgctccgcttggccaccttctgccatctgactgtc
ctgctggctggacagcaccacggtgtgacgaaatgcaacatcacgtgcagcaagatgaca
tcaaagatacctgtagctttgctcatccactatcaacagaaccaggcatcatgcggcaaa
cgcgcaatcatcttggagacgagacagcacaggctgttctgtgccgacccgaaggagcaa
tgggtcaaggacgcgatgcagcatctggaccgccaggctgctgccctaactcgaaatggc
ggcaccttcgagaagcagatcggcgaggtgaagcccaggaccacccctgccgccggggga
atggacgagtctgtggtcctggagcccgaagccacaggcgaaagcagtagcctggagccg
actccttcttcccaggaagcacagagggccctggggacctccccagagctgccgacgggc
gtgactggttcctcagggaccaggctccccccgacgccaaaggctcaggatggagggcct
gtgggcacggagcttttccgagtgcctcccgtctccactgccgccacgtggcagagttct
gctccccaccaacctgggcccagcctctgggctgaggcaaagacctctgaggccccgtcc
acccaggacccctccacccaggcctccactgcgtcctccccagccccagaggagaatgct
ccgtctgaaggccagcgtgtgtggggtcagggacagagccccaggccagagaactctctg
gagcgggaggagatgggtcccgtgccagcgcacacggatgccttccaggactgggggcct
ggcagcatggcccacgtctctgtggtccctgtctcctcagaagggacccccagcagggag
ccagtggcttcaggcagctggacccctaaggctgaggaacccatccatgccaccatggac
ccccagaggctgggcgtccttatcactcctgtccctgacgcccaggctgccacccggagg
caggcggtggggctgctggccttccttggcctcctcttctgcctgggggtggccatgttc
acctaccagagcctccagggctgccctcgaaagatggcaggagagatggcggagggcctt
cgctacatcccccggagctgtggtagtaattcatatgtcctggtgcccgtgtga

DBGET integrated database retrieval system