KEGG   Homo sapiens (human): 638Help
Entry
638               CDS       T01001                                 

Gene name
BIK, BIP1, BP4, NBK
Definition
(RefSeq) BCL2 interacting killer
  KO
K18452  Bcl-2-interacting killer
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09176 Drug resistance: Antineoplastic
   01522 Endocrine resistance
    638 (BIK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bcl-2I13 BID
Motif
Other DBs
NCBI-GeneID: 638
NCBI-ProteinID: NP_001188
OMIM: 603392
HGNC: 1051
Ensembl: ENSG00000100290
Vega: OTTHUMG00000150703
Pharos: Q13323(Tbio)
UniProt: Q13323 A0A024R4X6
Position
22q13.2
AA seq 160 aa AA seqDB search
MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALR
LACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMR
FWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagtaagacccctctccagagacatcttgatggagaccctcctgtatgagcag
ctcctggaacccccgaccatggaggttcttggcatgactgactctgaagaggacctggac
cctatggaggacttcgattctttggaatgcatggagggcagtgacgcattggccctgcgg
ctggcctgcatcggggacgagatggacgtgagcctcagggccccgcgcctggcccagctc
tccgaggtggccatgcacagcctgggtctggctttcatctacgaccagactgaggacatc
agggatgttcttagaagtttcatggacggtttcaccacacttaaggagaacataatgagg
ttctggagatccccgaaccccgggtcctgggtgtcctgcgaacaggtgctgctggcgctg
ctgctgctgctggcgctgctgctgccgctgctcagcgggggcctgcacctgctgctcaag
tga

DBGET integrated database retrieval system