KEGG   Homo sapiens (human): 63827Help
Entry
63827             CDS       T01001                                 

Gene name
BCAN, BEHAB, CSPG7
Definition
(RefSeq) brevican
  KO
K06795  brevican
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    63827 (BCAN)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    63827 (BCAN)
   04091 Lectins [BR:hsa04091]
    63827 (BCAN)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Aggrecan / versican family
   63827 (BCAN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   63827 (BCAN)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 1: Proteoglycan core proteins
   63827 (BCAN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Xlink Lectin_C V-set Sushi EGF hEGF EGF_2 ig I-set Izumo-Ig Ig_2 EGF_3
Motif
Other DBs
NCBI-GeneID: 63827
NCBI-ProteinID: NP_068767
OMIM: 600347
HGNC: 23059
Ensembl: ENSG00000132692
Vega: OTTHUMG00000033322
Pharos: Q96GW7(Tbio)
UniProt: Q96GW7
Position
1q23.1
AA seq 911 aa AA seqDB search
MAQLFLPLLAALVLAQAPAALADVLEGDSSEDRAFRVRIAGDAPLQGVLGGALTIPCHVH
YLRPPPSRRAVLGSPRVKWTFLSRGREAEVLVARGVRVKVNEAYRFRVALPAYPASLTDV
SLALSELRPNDSGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFSGAQEACA
RIGAHIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVV
DPDDLYDVYCYAEDLNGELFLGDPPEKLTLEEARAYCQERGAEIATTGQLYAAWDGGLDH
CSPGWLADGSVRYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSAQPS
AIPEASNPASNPASDGLEAIVTVTETLEELQLPQEATESESRGAIYSIPIMEDGGGGSST
PEDPAEAPRTLLEFETQSMVPPTGFSEEEGKALEEEEKYEDEEEKEEEEEEEEVEDEALW
AWPSELSSPGPEASLPTEPAAQEESLSQAPARAVLQPGASPLPDGESEASRPPRVHGPPT
ETLPTPRERNLASPSPSTLVEAREVGEATGGPELSGVPRGESEETGSSEGAPSLLPATRA
PEGTRELEAPSEDNSGRTAPAGTSVQAQPVLPTDSASRGGVAVVPASGDCVPSPCHNGGT
CLEEEEGVRCLCLPGYGGDLCDVGLRFCNPGWDAFQGACYKHFSTRRSWEEAETQCRMYG
AHLASISTPEEQDFINNRYREYQWIGLNDRTIEGDFLWSDGVPLLYENWNPGQPDSYFLS
GENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPELPLAQVFGRPRLRYEVDTVL
RYRCREGLAQRNLPLIRCQENGRWEAPQISCVPRRPARALHPEEDPEGRQGRLLGRWKAL
LIPPSSPMPGP
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggcccagctgttcctgcccctgctggcagccctggtcctggcccaggctcctgcagct
ttagcagatgttctggaaggagacagctcagaggaccgcgcttttcgcgtgcgcatcgcg
ggcgacgcgccactgcagggcgtgctcggcggcgccctcaccatcccttgccacgtccac
tacctgcggccaccgccgagccgccgggctgtgctgggctctccgcgggtcaagtggact
ttcctgtcccggggccgggaggcagaggtgctggtggcgcggggagtgcgcgtcaaggtg
aacgaggcctaccggttccgcgtggcactgcctgcgtacccagcgtcgctcaccgacgtc
tccctggcgctgagcgagctgcgccccaacgactcaggtatctatcgctgtgaggtccag
cacggcatcgatgacagcagcgacgctgtggaggtcaaggtcaaaggggtcgtctttctc
taccgagagggctctgcccgctatgctttctccttttctggggcccaggaggcctgtgcc
cgcattggagcccacatcgccaccccggagcagctctatgccgcctaccttgggggctat
gagcaatgtgatgctggctggctgtcggatcagaccgtgaggtatcccatccagacccca
cgagaggcctgttacggagacatggatggcttccccggggtccggaactatggtgtggtg
gacccggatgacctctatgatgtgtactgttatgctgaagacctaaatggagaactgttc
ctgggtgaccctccagagaagctgacattggaggaagcacgggcgtactgccaggagcgg
ggtgcagagattgccaccacgggccaactgtatgcagcctgggatggtggcctggaccac
tgcagcccagggtggctagctgatggcagtgtgcgctaccccatcgtcacacccagccag
cgctgtggtgggggcttgcctggtgtcaagactctcttcctcttccccaaccagactggc
ttccccaataagcacagccgcttcaacgtctactgcttccgagactcggcccagccttct
gccatccctgaggcctccaacccagcctccaacccagcctctgatggactagaggctatc
gtcacagtgacagagaccctggaggaactgcagctgcctcaggaagccacagagagtgaa
tcccgtggggccatctactccatccccatcatggaggacggaggaggtggaagctccact
ccagaagacccagcagaggcccctaggacgctcctagaatttgaaacacaatccatggta
ccgcccacggggttctcagaagaggaaggtaaggcattggaggaagaagagaaatatgaa
gatgaagaagagaaagaggaggaagaagaagaggaggaggtggaggatgaggctctgtgg
gcatggcccagcgagctcagcagcccgggccctgaggcctctctccccactgagccagca
gcccaggaggagtcactctcccaggcgccagcaagggcagtcctgcagcctggtgcatca
ccacttcctgatggagagtcagaagcttccaggcctccaagggtccatggaccacctact
gagactctgcccactcccagggagaggaacctagcatccccatcaccttccactctggtt
gaggcaagagaggtgggggaggcaactggtggtcctgagctatctggggtccctcgagga
gagagcgaggagacaggaagctccgagggtgccccttccctgcttccagccacacgggcc
cctgagggtaccagggagctggaggccccctctgaagataattctggaagaactgcccca
gcagggacctcagtgcaggcccagccagtgctgcccactgacagcgccagccgaggtgga
gtggccgtggtccccgcatcaggtgactgtgtccccagcccctgccacaatggtgggaca
tgcttggaggaggaggaaggggtccgctgcctatgtctgcctggctatgggggggacctg
tgcgatgttggcctccgcttctgcaaccccggctgggacgccttccagggcgcctgctac
aagcacttttccacacgaaggagctgggaggaggcagagacccagtgccggatgtacggc
gcgcatctggccagcatcagcacacccgaggaacaggacttcatcaacaaccggtaccgg
gagtaccagtggatcggactcaacgacaggaccatcgaaggcgacttcttgtggtcggat
ggcgtccccctgctctatgagaactggaaccctgggcagcctgacagctacttcctgtct
ggagagaactgcgtggtcatggtgtggcatgatcagggacaatggagtgacgtgccctgc
aactaccacctgtcctacacctgcaagatggggctggtgtcctgtgggccgccaccggag
ctgcccctggctcaagtgttcggccgcccacggctgcgctatgaggtggacactgtgctt
cgctaccggtgccgggaaggactggcccagcgcaatctgccgctgatccgatgccaagag
aacggtcgttgggaggccccccagatctcctgtgtgcccagaagacctgcccgagctctg
cacccagaggaggacccagaaggacgtcaggggaggctactgggacgctggaaggcgctg
ttgatccccccttccagccccatgccaggtccctag

DBGET integrated database retrieval system