KEGG   Homo sapiens (human): 6383Help
Entry
6383              CDS       T01001                                 

Gene name
SDC2, CD362, HSPG, HSPG1, SYND2
Definition
(RefSeq) syndecan 2
  KO
K16336  syndecan 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa05144  Malaria
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6383 (SDC2)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    6383 (SDC2)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6383 (SDC2)
  09174 Infectious diseases: Parasitic
   05144 Malaria
    6383 (SDC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    6383 (SDC2)
   00535 Proteoglycans [BR:hsa00535]
    6383 (SDC2)
CD molecules [BR:hsa04090]
 Proteins
  6383 (SDC2)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   6383 (SDC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan Glycophorin_A DUF2721 DUF5305 ATG22 Cadherin_C_2 Peptidase_M50 DUF3275
Motif
Other DBs
NCBI-GeneID: 6383
NCBI-ProteinID: NP_002989
OMIM: 142460
HGNC: 10659
Ensembl: ENSG00000169439
Vega: OTTHUMG00000164689
Pharos: P34741(Tbio)
UniProt: P34741 A0A024R9D1
Position
8q22.1
AA seq 201 aa AA seqDB search
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
LGERKPSSAAYQKAPTKEFYA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgcgtggatcctgctcaccttgggcttggtggcctgcgtgtcggcggagtcg
agagcagagctgacatctgataaagacatgtaccttgacaacagctccattgaagaagct
tcaggagtgtatcctattgatgacgatgactacgcttctgcgtctggctcgggagctgat
gaggatgtagagagtccagagctgacaacatctcgaccacttccaaagatactgttgact
agtgctgctccaaaagtggaaaccacgacgctgaatatacagaacaagatacctgctcag
acaaagtcacctgaagaaactgataaagagaaagttcacctctctgactcagaaaggaaa
atggacccagccgaagaggatacaaatgtgtatactgagaaacactcagacagtctgttt
aaacggacagaagtcctagcagctgtcattgctggtggagttattggctttctctttgca
atttttcttatcctgctgttggtgtatcgcatgagaaagaaggatgaaggaagctatgac
cttggagaacgcaaaccatccagtgctgcttatcagaaggcacctactaaggagttttat
gcgtaa

DBGET integrated database retrieval system