KEGG   Homo sapiens (human): 6383Help
Entry
6383              CDS       T01001                                 

Gene name
SDC2, CD362, HSPG, HSPG1, SYND2
Definition
(RefSeq) syndecan 2
  KO
K16336  syndecan 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa05144  Malaria
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6383 (SDC2)
 09160 Human Diseases
  09161 Cancers
   05205 Proteoglycans in cancer
    6383 (SDC2)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6383 (SDC2)
  09167 Infectious diseases
   05144 Malaria
    6383 (SDC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    6383 (SDC2)
   00535 Proteoglycans [BR:hsa00535]
    6383 (SDC2)
CD molecules [BR:hsa04090]
 Proteins
  6383 (SDC2)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   6383 (SDC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan Glycophorin_A DUF2721 DUF5305 ATG22 Cadherin_C_2 Peptidase_M50 DUF3275
Motif
Other DBs
NCBI-GeneID: 6383
NCBI-ProteinID: NP_002989
OMIM: 142460
HGNC: 10659
Ensembl: ENSG00000169439
Vega: OTTHUMG00000164689
Pharos: P34741(Tbio)
UniProt: P34741 A0A024R9D1
Position
8q22.1
AA seq 201 aa AA seqDB search
MRRAWILLTLGLVACVSAESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGAD
EDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERK
MDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYD
LGERKPSSAAYQKAPTKEFYA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgcgtggatcctgctcaccttgggcttggtggcctgcgtgtcggcggagtcg
agagcagagctgacatctgataaagacatgtaccttgacaacagctccattgaagaagct
tcaggagtgtatcctattgatgacgatgactacgcttctgcgtctggctcgggagctgat
gaggatgtagagagtccagagctgacaacatctcgaccacttccaaagatactgttgact
agtgctgctccaaaagtggaaaccacgacgctgaatatacagaacaagatacctgctcag
acaaagtcacctgaagaaactgataaagagaaagttcacctctctgactcagaaaggaaa
atggacccagccgaagaggatacaaatgtgtatactgagaaacactcagacagtctgttt
aaacggacagaagtcctagcagctgtcattgctggtggagttattggctttctctttgca
atttttcttatcctgctgttggtgtatcgcatgagaaagaaggatgaaggaagctatgac
cttggagaacgcaaaccatccagtgctgcttatcagaaggcacctactaaggagttttat
gcgtaa

DBGET integrated database retrieval system