KEGG   Homo sapiens (human): 6385Help
Entry
6385              CDS       T01001                                 

Gene name
SDC4, SYND4
Definition
(RefSeq) syndecan 4
  KO
K16338  syndecan 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa04514  Cell adhesion molecules (CAMs)
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    6385 (SDC4)
   04514 Cell adhesion molecules (CAMs)
    6385 (SDC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    6385 (SDC4)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6385 (SDC4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    6385 (SDC4)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Syndecan family (transmembrane HSPG)
   6385 (SDC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syndecan Glycophorin_A
Motif
Other DBs
NCBI-GeneID: 6385
NCBI-ProteinID: NP_002990
OMIM: 600017
HGNC: 10661
Ensembl: ENSG00000124145
Vega: OTTHUMG00000033083
Pharos: P31431(Tbio)
UniProt: P31431
Position
20q13.12
AA seq 198 aa AA seqDB search
MAPARLFALLLFFVGGVAESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFEL
SGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVE
ESEDVSNKVSMSSTVQGSNIFERTEVLAALIVGGIVGILFAVFLILLLMYRMKKKDEGSY
DLGKKPIYKKAPTNEFYA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgcccgtctgttcgcgctgctgctgttcttcgtaggcggagtcgccgagtcg
atccgagagactgaggtcatcgacccccaggacctcctagaaggccgatacttctccgga
gccctaccagacgatgaggatgtagtggggcccgggcaggaatctgatgactttgagctg
tctggctctggagatctggatgacttggaagactccatgatcggccctgaagttgtccat
cccttggtgcctctagataaccatatccctgagagggcagggtctgggagccaagtcccc
accgaacccaagaaactagaggagaatgaggttatccccaagagaatctcacccgttgaa
gagagtgaggatgtgtccaacaaggtgtcaatgtccagcactgtgcagggcagcaacatc
tttgagagaacggaggtcctggcagctctgattgtgggtggcatcgtgggcatcctcttt
gccgtcttcctgatcctactgctcatgtaccgtatgaagaagaaggatgaaggcagctat
gacctgggcaagaaacccatctacaagaaagcccccaccaatgagttctacgcgtga

DBGET integrated database retrieval system