KEGG   Homo sapiens (human): 63874
Entry
63874             CDS       T01001                                 
Symbol
ABHD4, ABH4
Name
(RefSeq) abhydrolase domain containing 4, N-acyl phospholipase B
  KO
K13698  abhydrolase domain-containing protein 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    63874 (ABHD4)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S33
   63874 (ABHD4)
SSDB
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 PAF-AH_p_II Ndr DUF915 Esterase PGAP1 DUF4875 Lipase_3
Other DBs
NCBI-GeneID: 63874
NCBI-ProteinID: NP_071343
OMIM: 619728
HGNC: 20154
Ensembl: ENSG00000100439
Pharos: Q8TB40(Tdark)
UniProt: Q8TB40
Position
14:22598300..22612963
AA seq 342 aa
MADDLEQQSQGWLSSWLPTWRPTSMSQLKNVEARILQCLQNKFLARYVSLPNQNKIWTVT
VSPEQNDRTPLVMVHGFGGGVGLWILNMDSLSARRTLHTFDLLGFGRSSRPAFPRDPEGA
EDEFVTSIETWRETMGIPSMILLGHSLGGFLATSYSIKYPDRVKHLILVDPWGFPLRPTN
PSEIRAPPAWVKAVASVLGRSNPLAVLRVAGPWGPGLVQRFRPDFKRKFADFFEDDTISE
YIYHCNAQNPSGETAFKAMMESFGWARRPMLERIHLIRKDVPITMIYGSDTWIDTSTGKK
VKMQRPDSYVRDMEIKGASHHVYADQPHIFNAVVEEICDSVD
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggccgatgatctggagcagcagtctcaaggctggctgagtagctggctgcccacgtgg
cgccccacttccatgtctcagctgaagaatgtggaagccaggatcctccagtgtctccag
aataagttcctggccagatatgtatccctcccaaaccagaataagatctggacggtgact
gtgagccccgagcaaaacgaccgcacccccttggtgatggtgcatggttttgggggcggc
gtgggtctctggatcctcaacatggactcactgagtgcccgccgcacactgcacaccttc
gatctgcttggcttcgggcgaagctcaaggccagcattcccaagggacccggagggggct
gaggatgagtttgtgacatcgatagagacatggcgggagaccatggggatccccagcatg
atcctcctggggcacagtttgggaggattcctggccacttcttactcaatcaagtaccct
gatagagttaaacacctcatcctggtggacccatggggctttcccctccgaccaactaac
cccagtgagatccgtgcacccccagcctgggtcaaagccgtggcatctgtcctaggacgt
tccaatccattggctgttcttcgagtagctgggccctgggggcctggtctggtgcagcga
ttccggccggacttcaaacgcaagtttgcagacttctttgaagatgataccatatcagag
tatatttaccactgcaacgcacagaatcccagtggtgagacagcattcaaagccatgatg
gagtcctttggctgggcccggcgccctatgctggagcgaattcacttgattcgaaaagat
gtgcctatcactatgatctacgggtccgacacctggatagataccagtacgggaaaaaag
gtgaagatgcagcggccggattcctatgtccgagacatggagattaagggtgcctcccac
catgtctatgctgaccagccacacatcttcaatgctgtggtggaggagatctgcgactca
gttgattga

DBGET integrated database retrieval system