KEGG   Homo sapiens (human): 6389Help
Entry
6389              CDS       T01001                                 

Gene name
SDHA, CMD1GG, FP, PGL5, SDH1, SDH2, SDHF
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00148  Succinate dehydrogenase (ubiquinone)
Disease
H00294  Dilated cardiomyopathy
H01022  Diseases of the tricarboxylic acid cycle
H01354  Leigh syndrome
H02005  Mitochondrial complex II deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6389 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6389 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6389 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6389 (SDHA)
   05012 Parkinson disease
    6389 (SDHA)
   05016 Huntington disease
    6389 (SDHA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6389 (SDHA)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     6389 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 6389
NCBI-ProteinID: NP_004159
OMIM: 600857
HGNC: 10680
Ensembl: ENSG00000073578
Vega: OTTHUMG00000090275
Pharos: P31040(Tbio)
UniProt: P31040 A0A024QZ30
Position
5p15.33
AA seq 664 aa AA seqDB search
MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKIS
KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccggggcctgtcgcggctgctgagcgctcggcgcctggcgctggccaag
gcgtggccaacagtgttgcaaacaggaacccgaggttttcacttcactgttgatgggaac
aagagggcatctgctaaagtttcagattccatttctgctcagtatccagtagtggatcat
gaatttgatgcagtggtggtaggcgctggaggggcaggcttgcgagctgcatttggcctt
tctgaggcagggtttaatacagcatgtgttaccaagctgtttcctaccaggtcacacact
gttgcagcacagggaggaatcaatgctgctctggggaacatggaggaggacaactggagg
tggcatttctacgacaccgtgaagggctccgactggctgggggaccaggatgccatccac
tacatgacggagcaggcccccgccgccgtggtcgagctagaaaattatggcatgccgttt
agcagaactgaagatgggaagatttatcagcgtgcatttggtggacagagcctcaagttt
ggaaagggcgggcaggcccatcggtgctgctgtgtggctgatcggactggccactcgcta
ttgcacaccttatatggaaggtctctgcgatatgataccagctattttgtggagtatttt
gccttggatctcctgatggagaatggggagtgccgtggtgtcatcgcactgtgcatagag
gacgggtccatccatcgcataagagcaaagaacactgttgttgccacaggaggctacggg
cgcacctacttcagctgcacgtctgcccacaccagcactggcgacggcacggccatgatc
accagggcaggccttccttgccaggacctagagtttgttcagttccaccctacaggcata
tatggtgctggttgtctcattacggaaggatgtcgtggagagggaggcattctcattaac
agtcaaggcgaaaggtttatggagcgatacgcccctgtcgcgaaggacctggcgtctaga
gatgtggtgtctcggtccatgactctggagatccgagaaggaagaggctgtggccctgag
aaagatcacgtctacctgcagctgcaccacctacctccagagcagctggccacgcgcctg
cctggcatttcagagacagccatgatcttcgctggcgtggacgtcacgaaggagccgatc
cctgtcctccccaccgtgcattataacatgggcggcattcccaccaactacaaggggcag
gtcctgaggcacgtgaatggccaggatcagattgtgcccggcctgtacgcctgtggggag
gccgcctgtgcctcggtacatggtgccaaccgcctcggggcaaactcgctcttggacctg
gttgtctttggtcgggcatgtgccctgagcatcgaagagtcatgcaggcctggagataaa
gtccctccaattaaaccaaacgctggggaagaatctgtcatgaatcttgacaaattgaga
tttgctgatggaagcataagaacatcggaactgcgactcagcatgcagaagtcaatgcaa
aatcatgctgccgtgttccgtgtgggaagcgtgttgcaagaaggttgtgggaaaatcagc
aagctctatggagacctaaagcacctgaagacgttcgaccggggaatggtctggaacacg
gacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagaccatctac
ggagcagaggcacggaaggagtcacggggcgcgcatgccagggaagactacaaggtgcgg
attgatgagtacgattactccaagcccatccaggggcaacagaagaagccctttgaggag
cactggaggaagcacaccctgtcctatgtggacgttggcactgggaaggtcactctggaa
tatagacccgtgatcgacaaaactttgaacgaggctgactgtgccaccgtcccgccagcc
attcgctcctactga

KEGG   Homo sapiens (human): 6390Help
Entry
6390              CDS       T01001                                 

Gene name
SDHB, CWS2, IP, PGL4, SDH, SDH1, SDH2, SDHIP
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00148  Succinate dehydrogenase (ubiquinone)
Disease
H01222  Cowden syndrome
H01510  Malignant paraganglioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6390 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6390 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6390 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6390 (SDHB)
   05012 Parkinson disease
    6390 (SDHB)
   05016 Huntington disease
    6390 (SDHB)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6390 (SDHB)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     6390 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 6390
NCBI-ProteinID: NP_002991
OMIM: 185470
HGNC: 10681
Ensembl: ENSG00000117118
Vega: OTTHUMG00000002289
Pharos: P21912(Tbio)
UniProt: P21912
Position
1p36.13
AA seq 280 aa AA seqDB search
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgccctctccttgaggcgccggttgccggccacaacccttggcgga
gcctgcctgcaggcctcccgaggagcccagacagctgcagccacagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tatgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaagttgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccacacatgtatgtgataaaggatcttgtt
cccgatttgagcaacttctatgcacagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagatgacttcacagaggagcgcctggccaagctgcaggacccattctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcagagatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

KEGG   Homo sapiens (human): 6391Help
Entry
6391              CDS       T01001                                 

Gene name
SDHC, CYB560, CYBL, PGL3, QPS1, SDH3
Definition
(RefSeq) succinate dehydrogenase complex subunit C
  KO
K00236  succinate dehydrogenase (ubiquinone) cytochrome b560 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00148  Succinate dehydrogenase (ubiquinone)
Disease
H01510  Malignant paraganglioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6391 (SDHC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6391 (SDHC)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6391 (SDHC)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6391 (SDHC)
   05012 Parkinson disease
    6391 (SDHC)
   05016 Huntington disease
    6391 (SDHC)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6391 (SDHC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-GeneID: 6391
NCBI-ProteinID: NP_002992
OMIM: 602413
HGNC: 10682
Ensembl: ENSG00000143252
Vega: OTTHUMG00000034468
Pharos: Q99643(Tbio)
UniProt: Q99643 A0A0S2Z4B7
Position
1q23.3
AA seq 169 aa AA seqDB search
MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYS
WSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFAL
VFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctgttgctgagacacgttggtcgtcattgcctccgagcccactttagccct
cagctctgtatcagaaatgctgttcctttgggaaccacggccaaagaagagatggagcgg
ttctggaataagaatataggttcaaaccgtcctctgtctccccacattactatctacagt
tggtctcttcccatggcgatgtccatctgccaccgtggcactggtattgctttgagtgca
ggggtctctctttttggcatgtcggccctgttactccctgggaactttgagtcttatttg
gaacttgtgaagtccctgtgtctggggccagcactgatccacacagctaagtttgcactt
gtcttccctctcatgtatcatacctggaatgggatccgacacttgatgtgggacctagga
aaaggcctgaagattccccagctataccagtctggagtggttgtcctggttcttactgtg
ttgtcctctatggggctggcagccatgtga

KEGG   Homo sapiens (human): 6392Help
Entry
6392              CDS       T01001                                 

Gene name
SDHD, CBT1, CII-4, CWS3, PGL, PGL1, QPs3, SDH4, cybS
Definition
(RefSeq) succinate dehydrogenase complex subunit D
  KO
K00237  succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00148  Succinate dehydrogenase (ubiquinone)
Disease
H00034  Carcinoid
H01222  Cowden syndrome
H01510  Malignant paraganglioma
H02005  Mitochondrial complex II deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6392 (SDHD)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6392 (SDHD)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6392 (SDHD)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6392 (SDHD)
   05012 Parkinson disease
    6392 (SDHD)
   05016 Huntington disease
    6392 (SDHD)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    6392 (SDHD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CybS Ldh_2
Motif
Other DBs
NCBI-GeneID: 6392
NCBI-ProteinID: NP_002993
OMIM: 602690
HGNC: 10683
Ensembl: ENSG00000204370
Vega: OTTHUMG00000166997
Pharos: O14521(Tbio)
UniProt: O14521 A0A0S2Z4J3
Position
11q23.1
AA seq 159 aa AA seqDB search
MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSK
AASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL
QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atggcggttctctggaggctgagtgccgtttgcggtgccctaggaggccgagctctgttg
cttcgaactccagtggtcagacctgctcatatctcagcatttcttcaggaccgacctatc
ccagaatggtgtggagtgcagcacatacacttgtcaccgagccaccattctggctccaag
gctgcatctctccactggactagcgagagggttgtcagtgttttgctcctgggtctgctt
ccggctgcttatttgaatccttgctctgcgatggactattccctggctgcagccctcact
cttcatggtcactggggccttggacaagttgttactgactatgttcatggggatgccttg
cagaaagctgccaaggcagggcttttggcactttcagctttaacctttgctgggctttgc
tatttcaactatcacgatgtgggcatctgcaaagctgttgccatgctgtggaagctctga

DBGET integrated database retrieval system