KEGG   Homo sapiens (human): 63895
Entry
63895             CDS       T01001                                 

Gene name
PIEZO2, C18orf30, C18orf58, DA3, DA5, DAIPT, FAM38B, FAM38B2, HsT748, HsT771, MWKS
Definition
(RefSeq) piezo type mechanosensitive ion channel component 2
  KO
K22128  piezo-type mechanosensitive ion channel component 1/2
Organism
hsa  Homo sapiens (human)
Disease
H00811  Distal arthrogryposis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    63895 (PIEZO2)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    63895 (PIEZO2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   Others
    63895 (PIEZO2)
Ion channels [BR:hsa04040]
 Other channels
  Mechanosensitive channel (Piezo)
   63895 (PIEZO2)
SSDB
Motif
Pfam: Piezo_RRas_bdg PIEZO
Other DBs
NCBI-GeneID: 63895
NCBI-ProteinID: NP_071351
OMIM: 613629
HGNC: 26270
Ensembl: ENSG00000154864
Vega: OTTHUMG00000178507
Pharos: Q9H5I5(Tbio)
UniProt: Q9H5I5
Position
18p11.22-p11.21
AA seq 2752 aa
MASEVVCGLIFRLLLPICLAVACAFRYNGLSFVYLIYLLLIPLFSEPTKTTMQGHTGRLL
KSLCFISLSFLLLHIIFHITLVSLEAQHRIAPGYNCSTWEKTFRQIGFESLKGADAGNGI
RVFVPDIGMFIASLTIWLLCRNIVQKPVTDEAAQSNPEFENEELAEGEKIDSEEALIYEE
DFNGGDGVEGELEESTKLKMFRRLASVASKLKEFIGNMITTAGKVVVTILLGSSGMMLPS
LTSSVYFFVFLGLCTWWSWCRTFDPLLFSCLCVLLAIFTAGHLIGLYLYQFQFFQEAVPP
NDYYARLFGIKSVIQTDCSSTWKIIVNPDLSWYHHANPILLLVMYYTLATLIRIWLQEPL
VQDEGTKEEDKALACSPIQITAGRRRSLWYATHYPTDERKLLSMTQDDYKPSDGLLVTVN
GNPVDYHTIHPSLPMENGPGKADLYSTPQYRWEPSDESSEKREEEEEEKEEFEEERSREE
KRSIKVHAMVSVFQFIMKQSYICALIAMMAWSITYHSWLTFVLLIWSCTLWMIRNRRKYA
MISSPFMVVYGNLLLILQYIWSFELPEIKKVPGFLEKKEPGELASKILFTITFWLLLRQH
LTEQKALQEKEALLSEVKIGSQENEEKDEELQDIQVEGEPKEEEEEEAKEEKQERKKVEQ
EEAEEEDEQDIMKVLGNLVVAMFIKYWIYVCGGMFFFVSFEGKIVMYKIIYMVLFLFCVA
LYQVHYEWWRKILKYFWMSVVIYTMLVLIFIYTYQFENFPGLWQNMTGLKKEKLEDLGLK
QFTVAELFTRIFIPTSFLLVCILHLHYFHDRFLELTDLKSIPSKEDNTIYRLAHPEGSLP
DLTMMHLTASLEKPEVRKLAEPGEEKLEGYSEKAQKGDLGKDSEESEEDGEEEEESEEEE
ETSDLRNKWHLVIDRLTVLFLKFLEYFHKLQVFMWWILELHIIKIVSSYIIWVSVKEVSL
FNYVFLISWAFALPYAKLRRLASSVCTVWTCVIIVCKMLYQLQTIKPENFSVNCSLPNEN
QTNIPFNELNKSLLYSAPIDPTEWVGLRKSSPLLVYLRNNLLMLAILAFEVTIYRHQEYY
RGRNNLTAPVSRTIFHDITRLHLDDGLINCAKYFINYFFYKFGLETCFLMSVNVIGQRMD
FYAMIHACWLIAVLYRRRRKAIAEIWPKYCCFLACIITFQYFICIGIPPAPCRDYPWRFK
GASFNDNIIKWLYFPDFIVRPNPVFLVYDFMLLLCASLQRQIFEDENKAAVRIMAGDNVE
ICMNLDAASFSQHNPVPDFIHCRSYLDMSKVIIFSYLFWFVLTIIFITGTTRISIFCMGY
LVACFYFLLFGGDLLLKPIKSILRYWDWLIAYNVFVITMKNILSIGACGYIGTLVHNSCW
LIQAFSLACTVKGYQMPAANSPCTLPSGEAGIIWDSICFAFLLLQRRVFMSYYFLHVVAD
IKASQILASRGAELFQATIVKAVKARIEEEKKSMDQLKRQMDRIKARQQKYKKGKERMLS
LTQEPGEGQDMQKLSEEDDEREADKQKAKGKKKQWWRPWVDHASMVRSGDYYLFETDSEE
EEEEELKKEDEEPPRRSAFQFVYQAWITDPKTALRQRHKEKKRSAREERKRRRKGSKEGP
VEWEDREDEPIKKKSDGPDNIIKRIFNILKFTWVLFLATVDSFTTWLNSISREHIDISTV
LRIERCMLTREIKKGNVPTRESIHMYYQNHIMNLSRESGLDTIDEHPGAASGAQTAHRMD
SLDSHDSISSEPTQCTMLYSRQGTTETIEEVEAEQEEEAGSTAPEPREAKEYEATGYDVG
AMGAEEASLTPEEELTQFSTLDGDVEAPPSYSKAVSFEHLSFGSQDDSAGKNRMAVSPDD
SRTDKLGSSILPPLTHELTASELLLKKMFHDDELEESEKFYVGQPRFLLLFYAMYNTLVA
RSEMVCYFVIILNHMVSASMITLLLPILIFLWAMLSVPRPSRRFWMMAIVYTEVAIVVKY
FFQFGFFPWNKNVEVNKDKPYHPPNIIGVEKKEGYVLYDLIQLLALFFHRSILKCHGLWD
EDDMTESGMAREESDDELSLGHGRRDSSDSLKSINLAASVESVHVTFPEQQTAVRRKRSG
SSSEPSQRSSFSSNRSQRGSTSTRNSSQKGSSVLSIKQKGKRELYMEKLQEHLIKAKAFT
IKKTLEIYVPIKQFFYNLIHPEYSAVTDVYVLMFLADTVDFIIIVFGFWAFGKHSAAADI
TSSLSEDQVPGPFLVMVLIQFGTMVVDRALYLRKTVLGKVIFQVILVFGIHFWMFFILPG
VTERKFSQNLVAQLWYFVKCVYFGLSAYQIRCGYPTRVLGNFLTKSYNYVNLFLFQGFRL
VPFLTELRAVMDWVWTDTTLSLSSWICVEDIYAHIFILKCWRESEKRYPQPRGQKKKKVV
KYGMGGMIIVLLICIVWFPLLFMSLIKSVAGVINQPLDVSVTITLGGYQPIFTMSAQQSQ
LKVMDQQSFNKFIQAFSRDTGAMQFLENYEKEDITVAELEGNSNSLWTISPPSKQKMIHE
LLDPNSSFSVVFSWSIQRNLSLGAKSEIATDKLSFPLKNITRKNIAKMIAGNSTESSKTP
VTIEKIYPYYVKAPSDSNSKPIKQLLSENNFMDITIILSRDNTTKYNSEWWVLNLTGNRI
YNPNSQALELVVFNDKVSPPSLGFLAGYGIMGLYASVVLVIGKFVREFFSGISHSIMFEE
LPNVDRILKLCTDIFLVRETGELELEEDLYAKLIFLYRSPETMIKWTREKTN
NT seq 8259 nt   +upstreamnt  +downstreamnt
atggcctcagaagtggtgtgcgggctcatcttcaggctgctgctgcccatctgcctggca
gtagcatgtgcattccgatacaatgggctctcctttgtctaccttatctacctcttgctc
attcctctgttctcagaaccaacaaaaacgacgatgcaaggacatacgggacggttatta
aagtctctgtgcttcatcagtctttccttcctgttgctgcacatcattttccacatcacg
ttggtgagccttgaagctcaacatcgtattgcacctggctacaactgctcaacatgggaa
aagacattccggcagatcggctttgaaagcttaaagggagctgatgctggcaatgggatc
agagtgtttgtacctgacatcgggatgttcattgctagtctgaccatctggctcctctgt
agaaacattgttcagaaacctgtgacagacgaagcagcacagagtaacccggagtttgaa
aatgaagaattggctgaaggagaaaaaattgattcagaagaggcactgatctatgaagag
gatttcaatggaggagatggtgttgaaggcgagttggaagaaagcacgaagttaaaaatg
ttccgcaggcttgcctctgtggcctctaagctcaaggagttcattggcaacatgatcacc
actgctgggaaagtcgttgttaccatcttactgggctcctcgggcatgatgttgccgtct
ttgacatcatctgtgtatttttttgtatttttgggtctgtgcacctggtggtcctggtgc
cggacgttcgacccattgctgttcagctgtctctgtgttctgctggctattttcactgct
ggacatttgattggactttatttataccagttccaattctttcaagaggcagttccaccc
aatgactactatgcaaggttgtttggtatcaagtcagtaattcaaacggactgttcaagt
acttggaagatcatagtgaacccggacctgtcgtggtaccaccacgccaaccctatcctc
ctgctggtgatgtactacactctggccactctgatccgcatctggctgcaagagcccctt
gtgcaggatgaggggaccaaagaagaggacaaagccctggcttgtagccccatccaaata
acagcggggaggaggcggagcctgtggtacgcaacccattaccccactgatgagagaaaa
cttttatccatgacccaggatgactacaaaccatctgatggcctgctggtgactgtgaac
ggcaaccccgtggattaccacaccatccacccaagcctgcccatggagaacggccctggc
aaagccgacctctactccacccctcagtaccggtgggagccctctgatgaatcctcagaa
aagcgagaggaggaagaggaagagaaagaagaatttgaagaagaaaggagccgtgaggaa
aaaagaagtatcaaagttcatgccatggtctccgtattccaatttattatgaaacaaagt
tacatctgtgccctcatagctatgatggcctggagcatcacctatcacagctggctgacc
ttcgtgctgctgatctggtcgtgcactctttggatgattcgcaacagaagaaaatatgcc
atgatcagctctcccttcatggtggtttatggaaacctattgttgatattacagtatata
tggagttttgaacttcctgaaattaaaaaagttccaggatttttagaaaagaaagagcca
ggagaacttgcttccaaaatccttttcaccattactttttggctactgctgaggcagcac
ctcacagagcaaaaagctctgcaagaaaaggaagctcttttatcggaagtcaaaattggc
agtcaggaaaatgaagaaaaagatgaggaacttcaagatatacaagtggaaggagagccc
aaagaggaggaagaagaggaagcgaaggaagagaagcaagagagaaagaaggtagagcaa
gaggaagctgaagaagaagatgagcaggacatcatgaaagtcctgggcaatctggtggtg
gccatgttcatcaagtactggatctacgtctgcggaggcatgttcttcttcgtcagcttc
gagggtaaaatcgtaatgtacaaaatcatctacatggtgctgttcctgttctgtgtggcc
ctataccaggtgcactatgaatggtggaggaaaattctaaaatatttttggatgtcagtg
gttatttacactatgctggtgcttatctttatatacacatatcagtttgagaacttccca
ggcctgtggcaaaatatgactggactgaaaaaagaaaagcttgaggatcttggcttaaag
cagtttactgtggctgaactattcactcgcatattcatcccaacctcctttctgctggtg
tgcattttacacctgcactacttccatgaccggttccttgaactcacagacctcaagtcc
attcccagcaaagaagacaacaccatctacagactggcccacccggaaggaagcctcccg
gacctcaccatgatgcatctgactgccagcctggagaagccggaggtgaggaagttggct
gagcctggggaggagaagcttgagggctactctgaaaaagcccagaagggtgatcttggg
aaagacagcgaggagtcagaggaggacggagaggaagaggaggaatccgaggaggaggaa
gaaacatcagacttaaggaacaaatggcacctggtgattgaccgcctcactgtgctcttc
ttaaaattcctggagtattttcacaagctgcaggtgttcatgtggtggattttggagttg
cacatcatcaaaatcgtttcctcttacattatctgggtttctgtgaaagaggtgtctctg
ttcaactatgtatttttgatttcttgggcttttgctctgccgtacgccaagctgcgccgt
ctggcttcaagtgtctgcacagtctggacgtgtgtgatcatcgtctgcaaaatgttgtac
cagctccaaaccattaagcctgagaacttctctgttaactgttccttgccaaatgaaaat
caaacaaacatcccctttaatgagttgaacaagtctctgctctacagcgctcctatcgat
cctacagagtgggtcggcctgcggaagtcttcgcctctgctagtctacctgaggaataac
ctcctgatgctggctatcctggcctttgaagtcaccatttaccgccatcaggaatactat
cgaggtcgaaataacctgacggcccctgtgtctagaactatctttcatgacattacaaga
ctacatctagatgatggacttattaattgtgccaaatatttcattaattacttcttttac
aagtttggtctggagacctgtttcctaatgtcagttaacgtcattggccagcgaatggat
ttctatgccatgatccacgcctgctggctgatcgctgtcttatatagacgcagaaggaaa
gccatcgcagagatctggcccaagtactgctgcttcctggcatgcatcatcaccttccag
tatttcatctgcattggcatcccacctgctccttgccgagattacccgtggagattcaag
ggtgccagcttcaatgacaacatcataaagtggctgtacttcccagatttcattgtgcgg
cccaaccctgtgtttctcgtctatgacttcatgctgcttctgtgtgcctccttacaacgg
cagatttttgaggatgagaacaaggctgcagtgcgaatcatggcaggtgacaatgtcgag
atctgcatgaaccttgatgcggcctccttcagccaacataaccctgtgccagattttatt
cactgcagatcttacttagacatgtccaaagtgatcatcttcagctacctcttctggttt
gtgctcaccatcatcttcatcactgggaccaccaggatcagcatcttttgcatggggtac
ctggtggcctgtttctacttcctgctctttgggggcgatttgctgttgaaacccatcaag
agcatcctgcgctactgggactggctgatcgcatacaacgtttttgtgattacgatgaaa
aatatcctgtcaataggagcatgtggatacattggaacattggtgcacaatagttgttgg
ttgatccaggctttcagcctggcctgcacagtcaaaggctatcaaatgcctgctgctaat
tcaccctgtacacttcccagtggggaagcaggaatcatttgggacagcatatgttttgcc
ttcctcctgctgcaaagaagagttttcatgagttattattttctacatgttgtggctgat
ataaaagcttcccagattctggcatcaagaggagctgaacttttccaggccacaattgta
aaagctgtaaaggcaagaattgaggaagagaagaagtccatggaccagctgaagcgacag
atggatcgcatcaaggccaggcaacagaaatataaaaagggtaaggagaggatgctgagc
ttgacccaggagccaggggaaggccaggacatgcaaaaactctctgaagaggatgatgaa
agagaagcagacaaacagaaagccaagggcaaaaaaaagcagtggtggcggccttgggtt
gatcatgcttccatggtcaggagtggagattattatttgtttgaaacggatagtgaagag
gaggaagaggaagaattaaagaaggaagatgaagaacctccacgaaggtcagcattccag
tttgtttatcaagcctggattactgatcctaaaacagcactccgacaaagacacaaagag
aaaaaaaggtctgcaagagaagaacggaaacgaaggcggaaaggatccaaggagggtcct
gtggaatgggaagaccgggaggatgaaccaatcaaaaagaaatccgatggaccagataat
atcatcaagaggatatttaatattttgaaatttacctgggtcctatttctggcaacagtg
gacagtttcactacttggcttaactccatttcaagggagcatattgatatatctacagtt
ctgagaattgaacgatgcatgctgaccagagaaattaagaagggcaatgttccaactcgg
gagagcatccacatgtactatcagaaccacatcatgaacctttccagagagtcgggactg
gacaccattgacgagcatcccggagctgcttcaggtgcacagacagcccacaggatggat
agtttagattcacatgacagtatctccagcgagcccacgcagtgtaccatgctgtactca
cgccaggggaccactgagaccatcgaggaggtggaggctgagcaggaggaggaggcaggg
agcacggcgcctgagcccagggaggccaaggagtacgaggccactgggtacgatgtggga
gccatgggtgccgaggaggccagcctcaccccagaggaagagctgacacagttctccacc
ttggacggggatgtggaggccccaccctcctacagcaaggctgtgagcttcgagcatctg
tccttcggctcgcaggacgactctgcaggcaagaaccgtatggcagtcagcccggacgac
agccgcaccgacaagctggggtccagcatcttacctcccctgacccatgagctgacggcc
agcgagctgctgctgaaaaagatgtttcacgacgatgagcttgaagagtcagagaaattc
tacgtggggcagccccgatttctgctgctcttctatgccatgtacaataccctggtggcc
cgctcggagatggtgtgctacttcgtgatcatcctcaaccacatggtctctgcctccatg
atcacgctcctgcttcccatcctcatcttcctctgggccatgttgtccgtccccaggccc
agccgccggttctggatgatggccatcgtctatactgaggtggcaattgtagtcaagtat
ttcttccaatttgggttctttccctggaataagaatgtggaggtgaacaaagataaaccg
tatcaccccccaaacatcataggagtggaaaagaaggaaggttatgttctctatgacctc
atccagctcctggctctgttctttcatcgatcaattttgaagtgccatggcttatgggat
gaagatgacatgactgaaagtggcatggccagggaggaatcagatgatgagctctccctc
ggtcatggcaggagggactcctccgattctctcaagtccatcaacctggccgcgtctgtg
gagtcagtgcatgtgaccttcccggagcagcagacagctgtccggaggaagcgctccggc
agcagctccgagccatcccagagatccagcttttcttcaaacagatcccaaagaggcagc
acaagcacccgaaacagcagtcaaaaaggaagcagtgttttgagtattaagcaaaaaggc
aaaagggaactttatatggaaaagcttcaagaacatttaatcaaagcaaaagcctttacc
ataaagaagacgctggagatctatgtgcccatcaaacagttcttttacaacctcatccac
ccggagtatagcgccgtgactgacgtgtatgtactcatgttcctggctgacactgtggac
ttcatcatcattgtcttcggcttttgggcctttgggaaacactcagcagctgcagacatc
acctcttcactgtcagaggaccaggtcccggggccgtttttggtgatggtcctcattcag
tttggaaccatggtggtggaccgagccctctacctcaggaagactgtactgggaaaggtc
atcttccaggtcattcttgtgttcggaattcacttctggatgttcttcatcttacctggt
gtgactgagaggaaattcagccagaacctggttgcccagctttggtactttgtgaaatgt
gtttacttcgggttgtctgcttaccagatccgttgtggctacccaacgcgagtcctgggg
aacttcctcaccaagagctacaattacgtcaacctcttcttattccaagggtttcgcctc
gtgccctttttgactgagctgagggcagtgatggactgggtgtggacggacacaactttg
agcctgtccagctggatctgtgtggaggacatctatgctcacatattcatcctgaagtgt
tggcgggagtcggagaagagataccctcagccacggggccagaagaagaagaaagtggtg
aagtatggcatgggaggaatgatcatcgtcctgctcatctgcattgtctggtttcctctt
ctcttcatgtctttgatcaaatctgtggctggggtcatcaaccagcccctggacgtctcc
gtcacaattaccctgggagggtatcagcctattttcacaatgagtgcccaacaaagccag
ttgaaagttatggaccagcagagctttaacaaatttatacaagctttttctagggacacc
ggtgctatgcaatttctggaaaattatgaaaaagaagacataacagtagcagaactggaa
ggaaactcaaattctttgtggaccatcagcccacccagtaagcagaaaatgatacacgaa
ctcctggaccccaatagtagcttctctgttgttttttcatggagtattcagagaaactta
agtctgggtgcaaaatcggaaatagcaacagataagctttcttttcctcttaaaaatatt
actcgaaagaatatcgctaaaatgatagcaggcaacagcacagaaagttcaaaaacacca
gtgaccatagaaaagatttatccatattatgtgaaagcacctagtgattctaactcaaaa
cctataaagcaacttttatctgaaaataatttcatggatattaccatcattttgtccaga
gacaatacaactaaatataacagtgagtggtgggttctcaacctgactggaaacagaata
tacaatccgaactctcaggccctggaactggtggtcttcaatgacaaagtcagtccccca
agtctggggttcctggctggctatggtattatgggattatatgcttcagttgtccttgtg
attgggaaatttgtccgtgaattcttcagtgggatttctcactccatcatgtttgaagag
cttccaaatgtggatcgaattttgaagttgtgcacagatatttttttagttcgagagaca
ggagaactggagctagaagaagatctctatgccaaattaatattcctatatcgctcacca
gagacaatgatcaaatggactagagaaaaaacaaattga

DBGET integrated database retrieval system