KEGG   Homo sapiens (human): 63897
Entry
63897             CDS       T01001                                 
Symbol
HEATR6, ABC1
Name
(RefSeq) HEAT repeat containing 6
  KO
K24815  HEAT repeat-containing protein 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    63897 (HEATR6)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  HEAT repeat domain-containing proteins
   63897 (HEATR6)
SSDB
Motif
Pfam: DUF4042 HEAT_2 HEAT HEAT_EZ Adaptin_N
Other DBs
NCBI-GeneID: 63897
NCBI-ProteinID: NP_071353
HGNC: 24076
Ensembl: ENSG00000068097
Pharos: Q6AI08(Tdark)
UniProt: Q6AI08
Position
17:complement(60041008..60078921)
AA seq 1181 aa
MAAVQVVGSWPSVQPREAPREAIPERGNGFRLLSARLCALRPDDSSSARTEIHLLFDQLI
SENYSEGSGVAPEDVSALLVQACRLVPLNQNHLVSKVSQLIHHLLNRLQVIVDEQHLDFL
LAYTISAIHQCSSWTHREILQALAALVYCNGSKCQKYLPELLGNTGLLMKLSDLAQSDPE
VRRAAVHCMANLCLSVPGQPYLEEPYQNVCFQAFLTILQSPKSSDMDDITFCMLLQNALK
GIQSLLNGGRMKLTQTDELGALLAVLKKFMFHGLPGLNIEMPTVLYPTPLPQYDGRTPIK
PQQSESSASRPTLNKKKKSKVKPKKIQQGEEEEKESSGEIEAAPVTGTGRVNLHEGNTWC
PSSLGVQSLPLDGSGAAEKDGVSSSFSSSSWKRVSSSESDFSDAEGGMQSKMRSYQAKVR
QGALVCFLSTIKSIEKKVLYGYWSAFIPDTPELGSPQSVSLMTLTLKDPSPKTRACALQV
LSAILEGSKQFLSVAEDTSDHRRAFTPFSVMIACSIRELHRCLLLALVAESSSQTVTQII
KCLANLVSNAPYDRLKLSLLTKVWNQIKPYIRHKDVNVRVSSLTLLGAIVSTHAPLPEVQ
LLLQQPCSSGLGNSNSATPHLSPPDWWKKAPAGPSLEETSVSSPKGSSEPCWLIRLCISI
VVLPKEDSCSGSDAGSAAGSTYEPSPMRLEALQVLTLLARGYFSMTQAYLMELGEVICKC
MGEADPSIQLHGAKLLEELGTGLIQQYKPDSTAAPDQRAPVFLVVMFWTMMLNGPLPRAL
QNSEHPTLQASACDALSSILPEAFSNLPNDRQMLCITVLLGLNDSKNRLVKAATSRALGV
YVLFPCLRQDVIFVADAANAILMSLEDKSLNVRAKAAWSLGNLTDTLIVNMETPDPSFQE
EFSGLLLLKMLRSAIEASKDKDKVKSNAVRALGNLLHFLQPSHIEKPTFAEIIEESIQAL
ISTVLTEAAMKVRWNACYAMGNVFKNPALPLGTAPWTSQAYNALTSVVTSCKNFKVRIRS
AAALSVPGKREQYGSVDQYARIWNALVTALQKSEDTIDFLEFKYCVSLRTQICQALIHLL
SLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMG
SIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGALPGLTNQ
NT seq 3546 nt   +upstreamnt  +downstreamnt
atggctgctgtgcaagttgtcggttcgtggccttccgtgcagccgcgggaggcaccgcgg
gaagcaatccctgagcgaggcaatgggtttcgcctcttgtctgccaggctctgcgccctg
cgcccggatgacagcagctccgcccgcaccgagatccacctgctcttcgatcagctcatc
tccgagaactacagcgagggcagtggcgtggccccggaggacgttagtgctcttcttgtc
caggcttgccgactggtacctcttaatcagaatcatcttgtcagcaaagtgagccagctt
atccaccatttacttaacagattacaggtaattgttgatgaacagcacttggatttcctg
ttggcatatactatttcggctattcatcagtgtagttcctggacacacagggaaattctt
caagccctggcagctctggtgtactgcaatggctccaaatgtcaaaagtacctcccagag
ctgctaggcaacaccggactcttaatgaagttgagtgacttggctcagtctgatcctgaa
gtcaggagagctgcagtacattgtatggcaaacttatgtctcagtgtgccaggacagccg
tatttggaggagccctaccaaaatgtctgtttccaagcttttctgactattttacagtct
ccaaaatcatctgatatggatgatatcacattttgcatgttattgcaaaatgcattaaaa
ggtatacagtcacttctaaatggtgggagaatgaaactaacacagactgatgaacttgga
gcacttttagctgtgctaaagaaattcatgtttcacggactccctggactaaacatagag
atgcccacggtgttatacccaactccgcttcctcagtatgatgggcgaacacctatcaaa
ccacagcaatcagaatccagtgcttctcgaccaactttgaataaaaagaaaaaatccaaa
gtaaaaccaaagaaaatccagcaaggagaggaggaggaaaaggaatccagtggtgaaata
gaggcagccccagtcactggcacaggcagagtgaacctgcatgaagggaacacttggtgt
ccctcctccctgggtgtccagagtttgcctttagatggaagtggagctgcagaaaaagat
ggagtctcctcatccttcagttcttccagttggaaaagggtcagcagtagtgagtcagac
ttttctgatgctgaaggaggcatgcagagtaaaatgaggtcttaccaagctaaagttcgc
caaggagccttagtttgttttctttctactataaaatcgatagaaaaaaaagttctttat
ggctactggtcagcttttattcctgatacgcctgaacttggcagcccacagtcagtgtcc
ttgatgactcttacattgaaagacccttctccaaagacacgtgcctgtgctctgcaagtt
ttatctgccatcttggaaggctcaaagcagtttctttctgttgctgaagataccagtgac
cacagaagggcttttacccccttctccgtaatgatcgcttgcagcattagagagttgcac
agatgtcttttgttagctttggtggcggagtcatcctcacagaccgttactcagataatt
aagtgccttgcaaatttagtatcaaatgcaccttatgatcgtctaaaactcagcctgctg
accaaagtctggaaccagataaagccttatattcgccacaaagatgttaatgttcgtgtg
tcaagtctcacactcttgggagctatagtgtccacccacgcacctttacctgaagtccaa
ctacttctgcaacagccatgttcttctggactcggtaatagcaattcagcaacccctcac
ctcagccctcctgattggtggaagaaagcccctgcaggaccctctctggaagaaacgtca
gttagctcacctaaggggtcttcagagccctgctggctcattcgactctgcatttccatt
gtcgtactgcccaaggaggattcctgttcaggtagcgatgctggctctgcagcaggaagc
acctacgaaccatcccccatgcgactggaggccttacaggtattgactcttctggcaagg
ggctacttttcaatgactcaagcctacttgatggagcttggagaggtgatttgcaagtgc
atgggggaagcagatccatccattcagcttcatggagcaaagcttctggaagaactgggc
acaggcttaatacagcagtataaaccagactccactgcagcacctgatcagagagcacca
gtcttcttggtggtgatgttctggactatgatgctgaacggtcctttacccagagccctg
cagaattcagaacacccaactctccaggcgagcgcctgtgatgccctgtcttccatcttg
ccagaggccttcagcaatctgccgaatgacaggcagatgctgtgcatcacagtgctgctc
gggctgaatgacagcaagaatcgcttagtgaaagctgcaacttcacgggccctgggagtc
tatgtgctttttccctgtctcagacaggatgtcatatttgttgcagacgcagcaaatgca
atattgatgtcacttgaagacaagtctctgaatgttcgagccaaagcagcctggtccctg
ggcaacctgacagacactctgattgtcaacatggaaacaccagacccaagtttccaggaa
gagttctctggtctcctgctcttgaaaatgttacgatcagctatagaagcatccaaggat
aaagacaaggtaaaaagcaatgcagtccgggcccttggaaatttgcttcattttctgcaa
ccctctcatatagaaaaacccacatttgcagaaatcattgaggagtctatccaggcccta
atttctactgttctaacagaagctgccatgaaagtccgatggaatgcttgttatgcaatg
ggaaatgtatttaaaaatcctgcccttcctttagggacagccccatggacctcccaggcc
tacaatgccctgacatcggtcgtgacatcatgcaagaacttcaaagtgcgcatcagatct
gcagctgccctttccgtcccggggaagagagagcagtacgggtctgttgaccagtatgct
cggatctggaatgcattggtcaccgctttacagaagagtgaagacaccatagactttttg
gaattcaagtactgtgtcagcctacggacccaaatctgccaggcactgattcacctcttg
agcttggccagtgcctcggacctcccttgtatgaaagaaacccttgaactgagtgggaat
atggtccagtcctatattctacagtttttaaaatcaggagcagagggagatgacactgga
gcaccccacagcccacaggaaagagaccagatggtcagaatggcccttaaacacatgggc
agcatccaggcaccaactggagacacagccagaagggccatcatgggctttttagaagag
atcctggccgtttgttttgactcatctggatcacaaggggcactcccagggttaacaaat
cagtga

DBGET integrated database retrieval system