KEGG   Homo sapiens (human): 63908Help
Entry
63908             CDS       T01001                                 

Gene name
NAPB, SNAP-BETA, SNAPB
Definition
(RefSeq) NSF attachment protein beta
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: SNAP TPR_12 TPR_7 Spatacsin_C DUF2150
Motif
Other DBs
NCBI-GeneID: 63908
NCBI-ProteinID: NP_071363
OMIM: 611270
HGNC: 15751
Ensembl: ENSG00000125814
Vega: OTTHUMG00000032062
Pharos: Q9H115(Tbio)
UniProt: Q9H115
Position
20p11.21
AA seq 298 aa AA seqDB search
MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAANMFKMAKNWSA
AGNAFCQAAKLHMQLQSKHDSATSFVDAGNAYKKADPQEAINCLNAAIDIYTDMGRFTIA
AKHHITIAEIYETELVDIEKAIAHYEQSADYYKGEESNSSANKCLLKVAAYAAQLEQYQK
AIEIYEQVGANTMDNPLLKYSAKDYFFKAALCHFIVDELNAKLALEKYEEMFPAFTDSRE
CKLLKKLLEAHEEQNSEAYTEAVKEFDSISRLDQWLTTMLLRIKKSIQGDGEGDGDLK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgcggggaaggagcgtgaggcagtacagctgatggcggaggccgagaagcga
gtcaaggcctcccactccttcctccgagggctgtttggaggaaacacaagaatagaagag
gcttgtgaaatgtataccagagctgcaaatatgttcaagatggctaaaaattggagtgct
gcaggaaacgcattttgtcaggcagccaagctccacatgcagcttcagagcaaacatgac
tctgctaccagctttgtggatgctggaaatgcttacaaaaaggcagatccccaagaggct
atcaactgcttaaatgcagccatcgacatttacacagacatgggaaggtttacaattgca
gccaagcaccacattactattgcagagatctatgagactgaacttgtagacattgagaag
gctattgcacattatgaacaatctgctgattattacaaaggagaagaatccaacagctca
gcaaacaagtgtctgctgaaggtggcagcatatgctgcccagcttgagcagtaccagaaa
gccattgagatctatgagcaggttggggcaaacacaatggataatcctttgttgaaatac
agtgcaaaggattacttcttcaaagctgccctctgccacttcatagtagacgagttgaat
gccaagcttgctcttgagaaatatgaggaaatgtttccagcatttactgattcaagagaa
tgtaaattattgaaaaaactcctagaagctcatgaagaacagaacagtgaagcttacact
gaagcagtgaaggaatttgactcaatatctcgcttggatcagtggctgaccaccatgttg
cttcgcatcaaaaagtccatccaaggggatggagaaggagatggagacctaaaatga

DBGET integrated database retrieval system