KEGG   Homo sapiens (human): 63910
Entry
63910             CDS       T01001                                 

Gene name
SLC17A9, C20orf59, POROK8, VNUT
Definition
(RefSeq) solute carrier family 17 member 9
  KO
K12303  MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 9
Organism
hsa  Homo sapiens (human)
Disease
H01933  Porokeratosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    63910 (SLC17A9)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC17: Vesicular glutamate transporter
   63910 (SLC17A9)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    63910 (SLC17A9)
SSDB
Motif
Pfam: MFS_1 DUF3042
Other DBs
NCBI-GeneID: 63910
NCBI-ProteinID: NP_071365
OMIM: 612107
HGNC: 16192
Ensembl: ENSG00000101194
Vega: OTTHUMG00000032951
Pharos: Q9BYT1(Tbio)
UniProt: Q9BYT1
Position
20q13.33
AA seq 436 aa
MQPPPDEARRDMAGDTQWSRPECQAWTGTLLLGTCLLYCARSSMPICTVSMSQDFGWNKK
EAGIVLSSFFWGYCLTQVVGGHLGDRIGGEKVILLSASAWGSITAVTPLLAHLSSAHLAF
MTFSRILMGLLQGVYFPALTSLLSQKVRESERAFTYSIVGAGSQFGTLLTGAVGSLLLEW
YGWQSIFYFSGGLTLLWVWYVYRYLLSEKDLILALGVLAQSRPVSRHNRVPWRRLFRKPA
VWAAVVSQLSAACSFFILLSWLPTFFEETFPDAKGWIFNVVPWLVAIPASLFSGFLSDHL
INQGYRAITVRKLMQGMGLGLSSVFALCLGHTSSFCESVVFASASIGLQTFNHSGISVNI
QDLAPSCAGFLFGVANTAGALAGVVGVCLGGYLMETTGSWTCLFNLVAIISNLGLCTFLV
FGQAQRVDLSSTHEDL
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgcagccacccccagacgaggcccgcagggacatggccggggacacccagtggtccagg
cccgagtgccaggcatggacggggacgctgctgctgggcacatgccttctgtactgcgcc
cgctccagcatgcccatctgcaccgtctccatgagccaggacttcggctggaacaagaag
gaggccggcatcgtgctcagcagcttcttctggggctactgcctgacacaggttgtgggc
ggccacctcggggatcggattgggggtgagaaggtcatcctgctgtcagcctctgcctgg
ggctccatcacggccgtcaccccactgctcgcccacctgagcagtgcccacctggccttc
atgaccttctcacgcatcctcatgggcttgctccaaggggtttacttccctgccctgacc
agcctgctgtcgcagaaggtgcgggagagtgagcgagccttcacctacagcatcgtgggc
gccggctcccagtttgggacgctgctgaccggggcggtgggctccctgctcctggaatgg
tacggctggcagagcatcttctatttctccggcggcctcaccttgctttgggtgtggtac
gtgtacaggtacctgctgagtgaaaaagatctcatcctggccttgggtgtcctggcccaa
agccggccggtgtccaggcacaacagagtcccctggagacggctcttccggaagcctgct
gtctgggcagccgtcgtctcccagctctctgcagcctgctccttcttcatcctcctctcc
tggctgcccaccttcttcgaggagaccttccccgacgccaagggctggatcttcaacgtg
gttccttggttggtggcgattccggccagtctattcagcgggtttctctctgatcatctc
atcaatcagggttacagagccatcacggtgcggaagctcatgcagggcatgggccttggc
ctctccagcgtctttgctctgtgcctgggccacacctccagcttctgtgagtctgtggtc
tttgcatcagcctccatcggcctccagaccttcaaccacagtggcatttctgttaacatc
caggacttggccccgtcctgcgccggctttctgtttggtgtggccaacacagccggggcc
ttggcaggtgtcgtgggtgtgtgtctaggcggctacttgatggagaccacgggctcctgg
acttgcctgttcaaccttgtggccatcatcagcaacctggggctgtgcaccttcctggtg
tttggacaggctcagagggtggacctgagctctacccatgaggacctctag

DBGET integrated database retrieval system