KEGG   Homo sapiens (human): 63923Help
Entry
63923             CDS       T01001                                 

Gene name
TNN, TN-W
Definition
(RefSeq) tenascin N
  KO
K06252  tenascin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa05165  Human papillomavirus infection
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    63923 (TNN)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    63923 (TNN)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    63923 (TNN)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    63923 (TNN)
  Infectious diseases
   05165 Human papillomavirus infection
    63923 (TNN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Extracellular matrix molecules
   63923 (TNN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 Fibrinogen_C DUF4998 Pur_ac_phosph_N EGF_2 DUF4959
Motif
Other DBs
NCBI-GeneID: 63923
NCBI-ProteinID: NP_071376
OMIM: 617472
HGNC: 22942
Ensembl: ENSG00000120332
Vega: OTTHUMG00000034882
Pharos: Q9UQP3(Tbio)
UniProt: Q9UQP3 B3KXB6
Position
1q25.1
AA seq 1299 aa AA seqDB search
MSLQEMFRFPMGLLLGSVLLVASAPATLEPPGCSNKEQQVTVSHTYKIDVPKSALVQVDA
DPQPLSDDGASLLALGEAREEQNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMV
EMKEQCSAQRCCQGVTDLSRHCSGHGTFSLETCSCHCEEGREGPACERLACPGACSGHGR
CVDGRCLCHEPYVGADCGYPACPENCSGHGECVRGVCQCHEDFMSEDCSEKRCPGDCSGH
GFCDTGECYCEEGFTGLDCAQVVTPQGLQLLKNTEDSLLVSWEPSSQVDHYLLSYYPLGK
ELSGKQIQVPKEQHSYEILGLLPGTKYIVTLRNVKNEVSSSPQHLLATTDLAVLGTAWVT
DETENSLDVEWENPSTEVDYYKLRYGPMTGQEVAEVTVPKSSDPKSRYDITGLHPGTEYK
ITVVPMRGELEGKPILLNGRTEIDSPTNVVTDRVTEDTATVSWDPVQAVIDKYVVRYTSA
DGDTKEMAVHKDESSTVLTGLKPGEAYKVYVWAERGNQGSKKADTNALTEIDSPANLVTD
RVTENTATISWDPVQATIDKYVVRYTSADDQETREVLVGKEQSSTVLTGLRPGVEYTVHV
WAQKGDRESKKADTNAPTDIDSPKNLVTDRVTENMATVSWDPVQAAIDKYVVRYTSAGGE
TREVPVGKEQSSTVLTGLRPGMEYMVHVWAQKGDQESKKADTKAQTDIDSPQNLVTDRVT
ENMATVSWDPVRATIDRYVVRYTSAKDGETREVPVGKEQSSTVLTGLRPGVEYTVHVWAQ
KGAQESKKADTKAQTDIDSPQNLVTDWVTENTATVSWDPVQATIDRYVVHYTSANGETRE
VPVGKEQSSTVLTGLRPGMEYTVHVWAQKGNQESKKADTKAQTEIDGPKNLVTDWVTENM
ATVSWDPVQATIDKYMVRYTSADGETREVPVGKEHSSTVLTGLRPGMEYMVHVWAQKGAQ
ESKKADTKAQTELDPPRNLRPSAVTQSGGILTWTPPSAQIHGYILTYQFPDGTVKEMQLG
REDQRFALQGLEQGATYPVSLVAFKGGRRSRNVSTTLSTVGARFPHPSDCSQVQQNSNAA
SGLYTIYLHGDASRPLQVYCDMETDGGGWIVFQRRNTGQLDFFKRWRSYVEGFGDPMKEF
WLGLDKLHNLTTGTPARYEVRVDLQTANESAYAIYDFFQVASSKERYKLTVGKYRGTAGD
ALTYHNGWKFTTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPW
KGHEFSIPYVELKIRPHGYSREPVLGRKKRTLRGRLRTF
NT seq 3900 nt NT seq  +upstreamnt  +downstreamnt
atgagtctccaggagatgttccgcttccctatggggctcctgcttggctctgtgctcctg
gtggcttcggccccagccactctggagcctcccggctgcagcaacaaggagcaacaggtc
actgtcagccacacctacaagatcgatgtgcccaagtctgccttggttcaggttgacgct
gaccctcagcccctcagtgacgatggggcttcgctcttggccctgggggaggccagggag
gaacagaacatcatcttcaggcacaacatccgccttcagacgccacagaaggactgcgag
ttggcaggcagtgtccaggacctcctggcccgggtgaagaagctggaggaagagatggtg
gagatgaaggaacagtgtagtgcccagcgctgctgccagggagtcactgatctaagccgc
cactgcagcggccacgggaccttctccctggagacctgcagctgccactgcgaagagggc
agggagggccccgcctgcgagcggctggcctgccccggggcgtgcagcggccacgggcgt
tgcgtggacgggcgctgcctgtgccatgagccctacgtgggtgccgactgcggctacccg
gcctgccctgagaactgcagcggacacggcgagtgcgtgcgcggcgtgtgccagtgccac
gaagacttcatgtcggaggactgcagcgagaagcgctgtcccggcgactgcagcggccac
ggcttctgtgacacgggcgagtgctactgcgaggagggcttcacaggcctggactgtgcc
caggtggtcaccccacagggcctgcagctgctcaagaacacggaggattctctgctggtg
agctgggagccctccagccaggtggatcactacctcctcagctactaccccctggggaag
gagctctctgggaagcagatccaagtgcccaaggagcagcacagctatgagattcttggt
ttgctgcctggaaccaagtacatagtcaccctgcgtaacgtcaagaatgaagtttctagc
agcccacagcatctacttgccaccacagaccttgctgtgcttggcactgcctgggtgaca
gatgagactgagaactcccttgacgtggagtgggaaaacccctcaactgaggtggactac
tacaagctgcgatatggccccatgacaggacaggaggtagctgaggtcactgtgcccaag
agcagtgaccccaagagccgatatgacatcactggtctgcacccggggactgagtataag
atcacggtggtgcccatgagaggagagctggagggcaagccgatcctcctgaatggcagg
acagaaattgacagtccaaccaatgttgtcactgatcgagtgactgaagacacagcaact
gtctcctgggacccagtgcaggctgtcatagacaagtatgtagtgcgctacacttctgct
gatggggacaccaaggaaatggcagtgcacaaggatgagagcagcactgtcctgacgggc
ctgaagccaggagaggcatacaaggtctacgtgtgggctgaaaggggcaaccaggggagc
aagaaagctgacaccaatgccctcacagaaattgacagcccagcaaacctggtgactgac
cgggtgactgagaataccgccaccatctcctgggacccggtacaggccaccattgacaag
tacgtggtgcgctacacctctgctgacgaccaagagaccagagaggttctggtggggaag
gagcagagcagcactgtcctgacaggcctgaggccaggtgtggagtacacagtgcatgtc
tgggcccagaagggggaccgagagagcaagaaggctgacaccaacgccccgacagatatt
gacagccccaaaaacctggtgactgaccgggtgacagagaatatggccacggtctcctgg
gacccggtgcaggccgccattgacaagtacgtggtgcgctacacctctgctggtggagag
accagggaggttccggtggggaaggagcagagcagcacagtcctgacaggcctgagaccg
ggtatggagtacatggtgcacgtgtgggcccagaagggggaccaggagagcaagaaggcc
gacaccaaggcccagacagacattgacagcccccaaaacctggtgaccgaccgggtgaca
gagaatatggccactgtctcctgggacccggtgcgggccaccattgacaggtatgtggtg
cgctacacctctgccaaggacggagagaccagggaggttccggtggggaaggagcagagt
agcactgtcctgacgggcctgaggccgggtgtggagtacacggtgcacgtgtgggcccag
aagggggcccaggagagcaagaaggctgacaccaaggcccagacagacattgacagcccc
caaaacctggtcactgactgggtgacagagaatacagccactgtctcctgggacccggtg
caggccaccattgacaggtatgtggtgcactacacgtctgccaacggagagaccagggag
gttccagtggggaaggagcagagcagcactgtcctgacgggcctgaggccgggcatggag
tacacggtgcacgtgtgggcccagaaggggaaccaggagagcaagaaggctgacaccaag
gcccagacagaaattgacggccccaaaaacctagtgactgactgggtgacggagaatatg
gccactgtctcctgggacccggttcaggccaccattgacaagtacatggtgcgctacacc
tctgctgacggagagaccagggaggttccggtggggaaggagcacagcagcactgtcctg
acgggcctgagaccaggcatggagtacatggtgcacgtgtgggcccagaagggggcccag
gagagcaagaaggctgacaccaaggcccagacagaactcgaccctcccagaaaccttcgt
ccatctgctgtaacgcagtctggtggcatattgacctggacgcccccctctgctcagatc
cacggctacattctgacttaccagttcccagatggcacagttaaggagatgcagctggga
cgggaagaccagaggtttgcgttgcaaggccttgagcaaggcgccacctaccctgtctcc
cttgttgcctttaagggtggtcgccggagcagaaatgtatccaccaccctctccacagtt
ggtgcccgtttcccacacccttcggactgcagtcaggttcagcagaacagcaatgccgcc
agtggtctgtacaccatctacctgcatggcgatgccagccggcccctgcaggtgtactgt
gacatggaaacggacggaggtggctggattgtcttccagaggcggaacactgggcagctg
gatttcttcaagcgatggaggagctatgtggaaggctttggggaccccatgaaggagttc
tggcttggacttgacaagctacacaacctcaccaccggcactccagcgcggtatgaggtg
agagtggatttacagactgccaatgaatctgcctatgctatatatgatttcttccaagtg
gcctccagcaaggagcggtataagctgacagttgggaaatacagaggcacggcaggggat
gctcttacttaccacaatggatggaagtttacaacttttgacagagacaatgatatcgca
ctcagcaactgtgccctgacacatcatggtggctggtggtataagaactgccacttggcc
aaccctaatggcagatatggggagaccaagcacagtgagggggtgaactgggagccttgg
aaaggacatgaattctccattccttacgtggagttgaaaatccgccctcatggctacagc
agggagcctgtcctgggcagaaagaagcggacgctgagaggaaggctgcgaacgttctga

DBGET integrated database retrieval system