KEGG   Homo sapiens (human): 63924
Entry
63924             CDS       T01001                                 
Symbol
CIDEC, CIDE-3, CIDE3, FPLD5, FSP27
Name
(RefSeq) cell death inducing DFFA like effector c
  KO
K25878  cell death activator CIDE-C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04923  Regulation of lipolysis in adipocytes
Disease
H00420  Familial partial lipodystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    63924 (CIDEC)
SSDB
Motif
Pfam: CIDE-N
Other DBs
NCBI-GeneID: 63924
NCBI-ProteinID: NP_001186481
OMIM: 612120
HGNC: 24229
Ensembl: ENSG00000187288
Pharos: Q96AQ7(Tbio)
UniProt: Q96AQ7
Position
3:complement(9866710..9880253)
AA seq 238 aa
MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMA
YSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPS
EQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGCLNVKATFYDTYSLSYDLHCCGA
KRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ
NT seq 717 nt   +upstreamnt  +downstreamnt
atggaatacgccatgaagtcccttagccttctctaccccaagtccctctccaggcatgtg
tcagtgcgtacctctgtggtgacccagcagctgctgtcggagcccagccccaaggccccc
agggcccggccctgccgcgtaagcacggcggatcgaagcgtgaggaagggcatcatggct
tacagtcttgaggacctcctcctcaaggtccgggacactctgatgctggcagacaagccc
ttcttcctggtgctggaggaagatggcacaactgtagagacagaagagtacttccaagcc
ctggcaggggatacagtgttcatggtcctccagaaggggcagaaatggcagcccccatca
gaacaggggacaaggcacccactgtccctctcccataagcctgccaagaagattgatgtg
gcccgtgtaacgtttgatctgtacaagctgaacccacaggacttcattggctgcctgaac
gtgaaggcgactttttatgatacatactccctttcctatgatctgcactgctgtggggcc
aagcgcatcatgaaggaagctttccgctgggccctcttcagcatgcaggccacaggccac
gtactgcttggcacctcctgttacctgcagcagctcctcgatgctacggaggaagggcag
ccccccaagggcaaggcctcatcccttatcccgacctgtctgaagatactgcagtga

DBGET integrated database retrieval system