KEGG   Homo sapiens (human): 63925Help
Entry
63925             CDS       T01001                                 

Gene name
ZNF335, MCPH10, NIF-1, NIF1, NIF2
Definition
(RefSeq) zinc finger protein 335
Organism
hsa  Homo sapiens (human)
Disease
H00269  Primary microcephaly
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_5 zf-C2H2_4 zf-C2H2 zf-H2C2_2 zf-C2H2_6 zf-Di19 ADK_lid Ribosomal_60s zf-C2H2_2 zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 63925
NCBI-ProteinID: NP_071378
OMIM: 610827
HGNC: 15807
Ensembl: ENSG00000198026
Vega: OTTHUMG00000032637
Pharos: Q9H4Z2(Tbio)
UniProt: Q9H4Z2 Q8IW09
Position
20q13.12
AA seq 1342 aa AA seqDB search
MEENEVESSSDAAPGPGRPEEPSESGLGVGTSEAVSADSSDAAAAPGQAEADDSGVGQSS
DRGSRSQEEVSESSSSADPLPNSYLPDSSSVSHGPVAGVTGGPPALVHSSALPDPNMLVS
DCTASSSDLGSAIDKIIESTIGPDLIQNCITVTSAEDGGAETTRYLILQGPDDGAPMTSP
MSSSTLAHSLAAIEALADGPTSTSTCLEAQGGPSSPVQLPPASGAEEPDLQSLEAMMEVV
VVQQFKCKMCQYRSSTKATLLRHMRERHFRPVAAAAAAAGKKGRLRKWSTSTKSQEEEGP
EEEDDDDIVDAGAIDDLEEDSDYNPAEDEPRGRQLRLQRPTPSTPRPRRRPGRPRKLPRL
EISDLPDGVEGEPLVSSQSGQSPPEPQDPEAPSSSGPGHLVAMGKVSRTPVEAGVSQSDA
ENAAPSCPDEHDTLPRRRGRPSRRFLGKKYRKYYYKSPKPLLRPFLCRICGSRFLSHEDL
RFHVNSHEAGDPQLFKCLQCSYRSRRWSSLKEHMFNHVGSKPYKCDECSYTSVYRKDVIR
HAAVHSRDRKKRPDPTPKLSSFPCPVCGRVYPMQKRLTQHMKTHSTEKPHMCDKCGKSFK
KRYTFKMHLLTHIQAVANRRFKCEFCEFVCEDKKALLNHQLSHVSDKPFKCSFCPYRTFR
EDFLLSHVAVKHTGAKPFACEYCHFSTRHKKNLRLHVRCRHASSFEEWGRRHPEEPPSRR
RPFFSLQQIEELKQQHSAAPGPPPSSPGPPEIPPEATTFQSSEAPSLLCSDTLGGATIIY
QQGAEESTAMATQTALDLLLNMSAQRELGGTALQVAVVKSEDVEAGLASPGGQPSPEGAT
PQVVTLHVAEPGGGAAAESQLGPPDLPQITLAPGPFGGTGYSVITAPPMEEGTSAPGTPY
SEEPAGEAAQAVVVSDTLKEAGTHYIMATDGTQLHHIELTADGSISFPSPDALASGAKWP
LLQCGGLPRDGPEPPSPAKTHCVGDSQSSASSPPATSKALGLAVPPSPPSAATAASKKFS
CKICAEAFPGRAEMESHKRAHAGPGAFKCPDCPFSARQWPEVRAHMAQHSSLRPHQCSQC
SFASKNKKDLRRHMLTHTKEKPFACHLCGQRFNRNGHLKFHIQRLHSPDGRKSGTPTARA
PTQTPTQTIILNSDDETLATLHTALQSSHGVLGPERLQQALSQEHIIVAQEQTVTNQEEA
AYIQEITTADGQTVQHLVTSDNQVQYIISQDGVQHLLPQEYVVVPEGHHIQVQEGQITHI
QYEQGAPFLQESQIQYVPVSPGQQLVTQAQLEAAAHSAVTAVADAAMAQAQGLFGTDETV
PEHIQQLQHQGIEYDVITLADD
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaacgaggtggagagcagcagcgacgcggcccctgggcctggccggcccgag
gagccctctgagagcggcctgggtgtgggcacctcagaagccgtgtccgccgacagcagc
gacgccgcggccgccccggggcaggcagaggccgatgactctggcgtggggcaaagctcg
gaccgcggcagccgttctcaggaggaggtatctgagagcagctcgagcgcagaccccctg
cctaatagctacctccctgattcatcgtctgtgtctcatgggccagtggcaggggtgaca
ggcggtcccccagcacttgtgcactctagtgcactcccagaccccaacatgctggtgtcc
gactgcacagcttcctcctcggacctgggctcggccatcgacaagatcatcgagtccacc
atcgggcccgacctcatccagaactgcatcactgtgaccagtgctgaggatggcggggcc
gagaccacacggtacctgatcctacagggcccagatgatggagcccccatgacatcacca
atgtccagttccaccttggcccacagcctagcagccattgaggccctggcagatggcccc
acatccacatccacatgcctggaggcacagggtgggcccagctccccggtgcagctgccc
ccagcctccggtgccgaagagccggacctgcagagcctggaggccatgatggaggtggtg
gtggtgcagcagttcaaatgcaagatgtgccagtaccggagcagcaccaaggccacactg
ctgcgccacatgcgggaacgccacttccgtccagtagcagcagccgcagcagcagctggt
aaaaaaggacgtctacggaagtggagcacctccaccaagagccaagaggaagagggacca
gaggaggaggacgatgatgacattgtagacgctggagccattgatgacctggaggaggat
agcgactataatccagctgaggatgagccccgaggccggcagcttcggctccagcgcccc
acccccagtaccccaaggccccgaaggagacctggccggccccggaagctgccccgcctg
gagatctcagacctcccagatggtgtggaaggagagcctctagtgagttcccagagtgga
cagagccctccagagccacaggatcccgaggctcccagctcctcaggcccaggacacctg
gtggccatgggcaaggtgagcaggacccctgtggaagctggtgtgagccagtcagatgca
gagaacgcagccccctcctgcccggatgagcatgacactctgccccggcgccgaggtcga
ccttccaggcgcttcctaggcaagaaataccgcaagtactattacaagtcgcccaaacca
cttttgaggcccttcctgtgccgcatctgtggttctcgctttctgtcccacgaggacctg
cgcttccacgtcaactcccatgaggctggcgatccccagctcttcaagtgcctgcagtgc
agctatcgttcccgccgctggtcctcgctcaaggagcacatgttcaaccacgtgggcagc
aagccctacaagtgtgacgagtgcagctacaccagtgtctaccggaaggacgtcattcgg
cacgccgctgtgcacagccgggaccggaagaagaggccagatccgactccaaagctgagc
tctttcccctgccctgtgtgtggccgtgtgtaccccatgcagaaaagactcacgcagcac
atgaagacgcacagcactgagaagccccacatgtgtgacaagtgtggaaagtcctttaag
aagcgctacaccttcaaaatgcacctgctcacgcacatccaggctgttgccaaccgcagg
ttcaagtgtgagttctgtgagtttgtttgtgaagacaagaaggcactgctgaaccaccag
ttgtcccacgtcagtgacaagcccttcaaatgcagcttttgtccctaccgcaccttccga
gaggacttcttgctgtcccatgtggctgtcaagcacacaggggccaagcccttcgcctgt
gagtactgccacttcagcacacggcacaagaagaacctgcgcctgcacgtacggtgccga
cacgcaagcagcttcgaggaatgggggaggcgccaccctgaggagcccccctcccgccgt
cgccccttcttctctctgcagcagattgaggagctgaagcagcagcacagtgcggcccct
ggaccacctcccagttccccaggacctcctgagatacccccagaggcgacaactttccag
tcatctgaggctccctcattgctctgttctgacaccctgggcggcgccaccatcatctac
cagcaaggagctgaggagtcgacagcgatggccacgcagacagccttggatcttctgctg
aacatgagtgctcagcgggaactggggggcacagccctgcaggtggctgtggtgaagtcg
gaagatgtggaagcagggttagcatcccctggtgggcagccctcccctgaaggtgccact
ccacaggtggtcaccctccacgtggcagagccagggggcggtgcagcagccgagagccag
ctaggccctcctgacctaccgcagatcaccctggcacctggtccatttggtgggactggc
tacagtgtcatcacagcaccccctatggaggagggaacatcagctcctggcacaccttac
agcgaggagcccgcaggagaggcagcccaggctgtggttgtgagtgacaccctaaaagaa
gctggcacccactacatcatggctactgatggtacccagttgcaccacattgagctcacc
gcagatggctccatctccttcccaagtccagatgctctggcctctggtgccaaatggccc
ctgctgcagtgtgggggactgcccagagacggccctgagcccccatctccagccaagacc
cactgcgtaggggactcccagagctctgcctcctcacctcctgcaaccagcaaagccctg
ggcctggcagtgcccccgtcaccgccatctgcagccactgctgcatcaaagaagttttcc
tgcaagatctgtgccgaggccttccctggccgagctgagatggagagtcacaagcgggcc
cacgctgggcctggtgccttcaagtgccccgactgccccttcagtgcccgccagtggccc
gaggtccgggcgcacatggcacagcactcaagcctacggccccaccagtgtagccagtgc
agctttgcctccaagaacaagaaggacctgcgtcggcacatgctgactcacacaaaggag
aagccttttgcatgccacctctgcgggcagcgtttcaaccgtaacgggcacctcaagttc
cacatccagcggctgcacagtcctgatgggaggaagtcaggaacccctacagcccgggcc
cctacccagaccccaacccagaccatcatcctgaacagtgatgacgaaacactggccacc
ctgcacactgcactccagtccagtcacggggtcctgggcccagagcggctacagcaggca
ctgagccaggaacacatcatcgttgcccaggaacagacagtgaccaatcaggaggaagcc
gcctacatccaagagatcaccacggcagatggccagaccgtacagcacctggtgacctcc
gacaaccaggtgcagtatatcatctcccaggatggtgtccagcacctgctcccccaggaa
tatgttgtggtccctgaaggccatcacatccaggtacaggagggccagatcacacacatc
cagtatgaacaaggagccccgttccttcaggagtcccagatccagtatgtgcctgtgtcc
ccaggccagcagcttgtcacacaggctcaacttgaggctgcagcacactcagctgtcaca
gcagtggctgatgctgccatggcccaagcccagggcctgtttggtacagacgagacagtg
cccgaacacattcaacagctgcagcaccagggcatcgagtacgacgtcatcaccctggcc
gatgactga

DBGET integrated database retrieval system