KEGG   Homo sapiens (human): 63932Help
Entry
63932             CDS       T01001                                 

Gene name
CXorf56, MRX107
Definition
(RefSeq) chromosome X open reading frame 56
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GFA DUF4410
Motif
Other DBs
NCBI-GeneID: 63932
NCBI-ProteinID: NP_071384
OMIM: 301012
HGNC: 26239
Ensembl: ENSG00000018610
Vega: OTTHUMG00000022276
Pharos: Q9H5V9(Tdark)
UniProt: Q9H5V9
Position
Xq24
AA seq 222 aa AA seqDB search
MPKVVSRSVVCSDTRDREEYDDGEKPLHVYYCLCGQMVLVLDCQLEKLPMRPRDRSRVID
AAKHAHKFCNTEDEETMYLRRPEGIERQYRKKCAKCGLPLFYQSQPKNAPVTFIVDGAVV
KFGQGFGKTNIYTQKQEPPKKVMMTKRTKDMGKFSSVTVSTIDEEEEEIEAREVADSYAQ
NAKVIEKQLERKGMSKRRLQELAELEAKKAKMKGTLIDNQFK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagtagtgtctcggtcagtagtctgctctgacactcgggaccgggaggaatat
gacgacggcgagaagcccctccatgtttactactgtttgtgcggccagatggtcctagtg
ctggactgccagttagagaaattgcccatgaggccccgggaccggtcccgtgtgattgat
gctgccaaacatgcccataagttttgtaacacagaagatgaggagactatgtatctgcgg
agacctgaaggcattgaacgacagtacaggaagaaatgtgcaaagtgtggactgccgctc
ttctaccaatcccagccaaagaatgctcctgttaccttcattgtggatggagcagtagtc
aagtttggccagggctttgggaaaacgaacatatatactcagaaacaagagcctcctaag
aaggtgatgatgaccaaacggaccaaagacatgggcaagttcagttctgtcaccgtgtct
accattgatgaagaggaagaggagattgaggctagggaagttgctgactcatatgcacag
aatgccaaagtgattgaaaaacagctggagcgcaaaggcatgagcaagaggcgactgcaa
gagctggctgaattggaagccaagaaagcgaaaatgaaggggaccttgattgacaaccag
ttcaaataa

DBGET integrated database retrieval system