KEGG   Homo sapiens (human): 63941
Entry
63941             CDS       T01001                                 
Symbol
NECAB3, APBA2BP, EFCBP3, NIP1, STIP3, SYTIP2, XB51, dJ63M2.4, dJ63M2.5
Name
(RefSeq) N-terminal EF-hand calcium binding protein 3
  KO
K23854  N-terminal EF-hand calcium-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    63941 (NECAB3)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   63941 (NECAB3)
SSDB
Motif
Pfam: ABM EF-hand_5 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 DivIC
Other DBs
NCBI-GeneID: 63941
NCBI-ProteinID: NP_112509
OMIM: 612478
HGNC: 15851
Ensembl: ENSG00000125967
Pharos: Q96P71(Tbio)
UniProt: Q96P71
Position
20:complement(33657087..33675348)
AA seq 396 aa
MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEE
FQNYFADGVLSLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAV
LAAMDATKLEYERASKVDQFVTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAES
VEAQSRLCGSRRAGRRALRSVSRSSTWSPGSSDTGRSSEAEMQWRLQVNRLQELIDQLEC
KVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLEPLREEDLAKGPDLHILMAQR
QVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQDEASWRRHQQ
SPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN
NT seq 1191 nt   +upstreamnt  +downstreamnt
atggcgtgcgcggggctgctcaccgtgtgcctgctccggccgcccgcgccccagccccag
ccccagaccccgcggcacccccagctcgcgcccgacccggggcccgccggacacacgctc
ttccaggacgttttccgcagagcagacaagaatgatgatgggaagctctcatttgaggaa
ttccagaattactttgccgatggggttctcagcctgggggagctgcaggaactgttcagc
ggcattgatgggcatctcaccgacaatttagaaacagaaaaactgtgtgactacttctca
gagcacctgggtgtctaccggccggtgctggctgcattggaatcgctgaaccgtgcagtg
ctcgctgccatggatgccaccaagctggagtacgagagggcctccaaagtggaccagttt
gtgacgcgcttcctgctgcgggagacggtgagccagctgcaagcccttcagagctcgctg
gagggggcgtcagataccctggaggcccaggcccatggctggcggtcagatgcagagagc
gtggaggcgcagagcaggctctgcggcagccggcgggcaggacgccgagccctgaggagt
gtcagccggtcatccacctggtcccccggctcttctgacacagggcgcagctcagaggcc
gagatgcagtggcggctccaggtgaaccgcctccaggagctcatcgaccagctcgagtgc
aaggtgagggccgtggggccagggccccacaagggaggaccctcctggtatccaccagag
ccaggcccatgctggaggcccggcccacactctgtgccctcacaggccccccggctggaa
cccctgcgtgaagaggacctggccaaggggcctgacttgcacatcctcatggcccagagg
caggtccaggtggcagaggaaggcctgcaggacttccaccgagccctgcgctgctatgtg
gacttcacaggggcccagagccattgtctgcatgtgtccgcccagaagatgctggacggt
gcctccttcaccctgtatgagttctggcaggatgaggcctcctggagaaggcaccagcag
tcgcctggcagcaaggccttccagcgcatcctcatcgaccacctgcgggccccggacacc
ctcaccactgtgttcttcccagcctcctggtggataatgaataacaactga

DBGET integrated database retrieval system