KEGG   Homo sapiens (human): 6396
Entry
6396              CDS       T01001                                 

Gene name
SEC13, D3S1231E, SEC13L1, SEC13R, npp-20
Definition
(RefSeq) SEC13 homolog, nuclear pore and COPII coat complex component
  KO
K14004  protein transport protein SEC13
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04141  Protein processing in endoplasmic reticulum
hsa04150  mTOR signaling pathway
hsa05014  Amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    6396 (SEC13)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6396 (SEC13)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    6396 (SEC13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    6396 (SEC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    6396 (SEC13)
   04131 Membrane trafficking [BR:hsa04131]
    6396 (SEC13)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     6396 (SEC13)
Membrane trafficking [BR:hsa04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    6396 (SEC13)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    6396 (SEC13)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 6396
NCBI-ProteinID: NP_899195
OMIM: 600152
HGNC: 10697
Ensembl: ENSG00000157020
Vega: OTTHUMG00000128671
Pharos: P55735(Tbio)
UniProt: P55735
Structure
PDB: 
3BG1 3BG0 5A9Q

Position
3p25.3
AA seq 322 aa
MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPV
WQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLIL
ACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIK
RFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRV
FIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCI
SDVNKGQGSVSASVTEGQQNEQ
NT seq 969 nt   +upstreamnt  +downstreamnt
atggtgtcagtaattaacactgtggatacctcccatgaggacatgattcacgacgcccag
atggactactatggcacccgcctggcaacctgctcatcagacaggtccgtcaaaatcttt
gatgtgcgcaatggagggcagatccttatcgccgacctcaggggtcatgagggtcctgtg
tggcaagtggcctgggctcaccccatgtacggcaacatcctggcatcgtgctcctatgac
cggaaagtcattatctggagagaggaaaacggcacctgggagaagagccacgagcatgcg
ggacacgactcctcagtgaactcggtgtgctgggccccccatgactacggcctgatcctg
gcctgtgggagctcggatggggccatctccctgctgacttacaccggggaaggccaatgg
gaagtaaagaagatcaacaacgctcacaccattggctgcaatgccgtcagctgggcccct
gctgttgtacctggaagcctcatagaccacccatcggggcagaaacccaattacatcaag
aggtttgcatcaggtggctgtgacaacctcatcaagctgtggaaggaggaggaggacggc
cagtggaaggaggagcagaagctagaagcgcacagtgactgggttcgagatgtggcctgg
gccccctccatcggcctgcccaccagcaccatcgccagctgctcccaggatggtcgtgtg
ttcatttggacctgtgatgatgcctcaagcaatacgtggtcccctaaattgttgcacaag
ttcaacgatgtggtgtggcatgtgagctggtccatcacagccaacatcctggctgtctct
ggtggagacaataaggtgaccctgtggaaggagtcagttgatgggcagtgggtgtgcatc
agtgatgtcaacaagggccagggctccgtatcagcatcagtgacagagggccagcagaac
gagcagtga

DBGET integrated database retrieval system