KEGG   Homo sapiens (human): 6397Help
Entry
6397              CDS       T01001                                 

Gene name
SEC14L1, PRELID4A, SEC14L
Definition
(RefSeq) SEC14 like lipid binding 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: PRELI CRAL_TRIO CRAL_TRIO_N
Motif
Other DBs
NCBI-GeneID: 6397
NCBI-ProteinID: NP_001137470
OMIM: 601504
HGNC: 10698
Ensembl: ENSG00000129657
Vega: OTTHUMG00000177311
Pharos: Q92503(Tdark)
UniProt: Q92503 Q7Z3R7 A0A024R8V1
Position
17q25.2-q25.3
AA seq 715 aa AA seqDB search
MVQKYQSPVRVYKYPFELIMAAYERRFPTCPLIPMFVGSDTVNEFKSEDGAIHVIERRCK
LDVDAPRLLKKIAGVDYVYFVQKNSLNSRERTLHIEAYNETFSNRVIINEHCCYTVHPEN
EDWTCFEQSASLDIKSFFGFESTVEKIAMKQYTSNIKKGKEIIEYYLRQLEEEGITFVPR
WSPPSITTSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVGTPDDKLD
ADYIKRYLGDLTPLQESCLIRLRQWLQETHKGKIPKDEHILRFLRARDFNIDKAREIMCQ
SLTWRKQHQVDYILETWTPPQVLQDYYAGGWHHHDKDGRPLYVLRLGQMDTKGLVRALGE
EALLRYVLSINEEGLRRCEENTKVFGRPISSWTCLVDLEGLNMRHLWRPGVKALLRIIEV
VEANYPETLGRLLILRAPRVFPVLWTLVSPFIDDNTRRKFLIYAGNDYQGPGGLLDYIDK
EIIPDFLSGECMCEVPEGGLVPKSLYRTAEELENEDLKLWTETIYQSASVFKGAPHEILI
QIVDASSVITWDFDVCKGDIVFNIYHSKRSPQPPKKDSLGAHSITSPGGNNVQLIDKVWQ
LGRDYSMVESPLICKEGESVQGSHVTRWPGFYILQWKFHSMPACAASSLPRVDDVLASLQ
VSSHKCKVMYYTEVIGSEDFRGSMTSLESSHSGFSQLSAATTSSSQSHSSSMISR
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagaaataccagtccccagtgagggtgtacaaatacccctttgaattaattatg
gctgcctatgaaaggaggttccctacatgtcctttgattccgatgttcgtgggcagtgac
actgtgaatgaattcaagagcgaagatggggctattcatgtcattgaaaggcgctgcaag
ctggatgtagatgcacccagactgctgaagaagattgcaggagttgattatgtttatttt
gtccagaaaaactcactgaattctcgggaacgtactttgcacattgaggcttataatgaa
acgttttccaatcgggtcatcattaatgagcattgctgctacaccgttcaccctgaaaat
gaagattggacctgttttgaacagtctgcaagtttagatattaaatctttctttggtttt
gaaagtacagtggaaaaaattgcaatgaaacaatataccagcaacattaaaaaaggaaag
gaaatcatcgaatactaccttcgccaattagaagaagaaggcataacctttgtgccccgt
tggagtccgccttccatcacgacctcttcagagacatcttcatcatcctccaagaaacaa
gcagcgtccatggccgtcgtcatcccagaagctgccctcaaggaggggctgagtggtgat
gccctcagcagccccagcgcacctgagcccgtggtgggcacccctgacgacaaactagat
gccgactacatcaagagatacctgggcgatttgactccgctgcaggagagctgcctcatt
agacttcgccagtggctccaggagacccacaagggcaaaattccaaaagatgagcatatt
cttcggttcctccgtgcacgggattttaatattgacaaagccagagagatcatgtgtcag
tctttgacgtggagaaagcagcatcaggtagactacattcttgaaacctggacccctcct
caggtccttcaggattactacgcgggaggctggcatcatcacgacaaagatgggcggccc
ctctacgtgctcaggctggggcagatggacaccaaaggcttggtgagagcgctcggggag
gaagccctgctgagatacgttctctccataaatgaagaagggctaaggcgatgcgaagag
aatacaaaagtctttggtcggcctatcagctcatggacctgcctggtggacttggaaggg
ctgaacatgcgccacttgtggagacctggtgtgaaagcgctgctgcggatcatcgaggtg
gtggaggccaactaccctgagacactgggccgccttctcatcctgcgggcgcccagggta
tttcctgtgctctggacgctggttagtccgttcattgatgacaacaccagaaggaagttc
ctcatttatgcaggaaatgactaccagggtcctggaggcctgctggattacatcgacaaa
gagattattccagatttcctgagtggggagtgcatgtgcgaagtgccagagggtggactg
gtccccaaatctctgtaccggactgcagaggagctggagaacgaagacctgaagctctgg
actgagaccatctaccagtctgcaagcgtcttcaaaggagccccacatgagattctcatt
cagattgtggatgcctcgtcagtcatcacttgggatttcgacgtgtgcaaaggggacatt
gtgtttaacatctatcactccaagaggtcgccacaaccacccaaaaaggactccctggga
gcccacagcatcacctctccgggtgggaacaatgtgcagctcatagacaaagtctggcag
ctgggccgcgactacagcatggtggagtcgcctctgatctgcaaagaaggagaaagcgtg
cagggttcccatgtgaccaggtggccgggcttctacatcctgcagtggaaattccacagc
atgcctgcgtgcgccgccagcagccttccccgggtggacgacgtgcttgcgtccctgcag
gtctcttcgcacaagtgtaaagtgatgtactacaccgaggtgatcggctcggaggatttc
agaggttccatgacgagcctggagtccagccacagcggcttctcccagctgagtgccgcc
accacctcctccagccagtcccactccagctccatgatctccaggtag

DBGET integrated database retrieval system