KEGG   Homo sapiens (human): 63974
Entry
63974             CDS       T01001                                 
Symbol
NEUROD6, Atoh2, MATH2, Math-2, NEX1M, Nex1, bHLHa2
Name
(RefSeq) neuronal differentiation 6
  KO
K09080  neurogenic differentiation factor 6
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    63974 (NEUROD6)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    63974 (NEUROD6)
SSDB
Motif
Pfam: Neuro_bHLH HLH
Other DBs
NCBI-GeneID: 63974
NCBI-ProteinID: NP_073565
OMIM: 611513
HGNC: 13804
Ensembl: ENSG00000164600
UniProt: Q96NK8 A0A090N7T3
Position
7:complement(31337465..31340726)
AA seq 337 aa
MLTLPFDESVVMPESQMCRKFSRECEDQKQIKKPESFSKQIVLRGKSIKRAPGEETEKEE
EEEDREEEDENGLPRRRGLRKKKTTKLRLERVKFRRQEANARERNRMHGLNDALDNLRKV
VPCYSKTQKLSKIETLRLAKNYIWALSEILRIGKRPDLLTFVQNLCKGLSQPTTNLVAGC
LQLNARSFLMGQGGEAAHHTRSPYSTFYPPYHSPELTTPPGHGTLDNSKSMKPYNYCSAY
ESFYESTSPECASPQFEGPLSPPPINYNGIFSLKQEETLDYGKNYNYGMHYCAVPPRGPL
GQGAMFRLPTDSHFPYDLHLRSQSLTMQDELNAVFHN
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgttaacactaccgtttgatgagtctgttgtaatgccagaatcccagatgtgcagaaag
ttttctagagaatgcgaggaccagaagcaaattaagaagccagaaagcttttccaaacag
attgtccttcgaggaaagagcatcaaaagggcccctggagaagaaaccgagaaagaagaa
gaggaggaagacagggaagaggaagatgaaaatgggttgcctagaaggaggggtcttagg
aaaaaaaagacaacaaagctgcgattggaaagggtcaagttcaggagacaggaagcgaac
gcgcgcgagaggaacaggatgcacggcctcaacgacgctctggacaacttaagaaaagtg
gtcccctgttattctaaaacccagaaactgtccaaaatagagactttacgactggccaaa
aactacatctgggcactttctgaaattctgagaatcggcaagagaccagatctgctcaca
ttcgtccaaaacttatgcaaaggtctttcccagccaactacaaacttggtggcaggctgc
ttgcagctcaacgccaggagtttcctgatgggtcagggtggggaggctgcacaccacaca
aggtcaccctactctaccttctacccaccctaccacagccctgagctcaccactccccca
gggcatgggactcttgataattccaagtccatgaaaccctacaattattgcagtgcgtat
gaatccttctatgaaagtacttcccctgagtgtgccagccctcagtttgaaggtccctta
agtcctcccccaattaactataatgggatattttccctgaagcaagaagaaaccttggac
tatggtaaaaattacaattacggcatgcattactgtgcagtgccacccaggggtcccctt
gggcagggtgccatgttcaggttgcccaccgacagccacttcccttacgacttacatctg
cgcagccaatctctcacaatgcaagatgaattaaatgcagtttttcataattaa

DBGET integrated database retrieval system