KEGG   Homo sapiens (human): 63982Help
Entry
63982             CDS       T01001                                 

Gene name
ANO3, C11orf25, DYT23, DYT24, GENX-3947, TMEM16C
Definition
(RefSeq) anoctamin 3
  KO
K19498  anoctamin-3
Organism
hsa  Homo sapiens (human)
Disease
H00831  Primary dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    63982 (ANO3)
Ion channels [BR:hsa04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   63982 (ANO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Anoctamin Anoct_dimer
Motif
Other DBs
NCBI-GeneID: 63982
NCBI-ProteinID: NP_113606
OMIM: 610110
HGNC: 14004
Ensembl: ENSG00000134343
Vega: OTTHUMG00000166096
Pharos: Q9BYT9(Tbio)
UniProt: Q9BYT9
Position
11p14.3-p14.2
AA seq 981 aa AA seqDB search
MVHHSGSIQSFKQQKGMNISKSEITKETSLKPSRRSLPCLAQSYAYSKSLSQSTSLFQST
ESESQAPTSITLISTDKAEQVNTEENKNDSVLRCSFADLSDFCLALGKDKDYTDESEHAT
YDRSRLINDFVIKDKSEFKTKLSKNDMNYIASSGPLFKDGKKRIDYILVYRKTNIQYDKR
NTFEKNLRAEGLMLEKEPAIASPDIMFIKIHIPWDTLCKYAERLNIRMPFRKKCYYTDGR
SKSMGRMQTYFRRIKNWMAQNPMVLDKSAFPDLEESDCYTGPFSRARIHHFIINNKDTFF
SNATRSRIVYHMLERTKYENGISKVGIRKLINNGSYIAAFPPHEGAYKSSQPIKTHGPQN
NRHLLYERWARWGMWYKHQPLDLIRLYFGEKIGLYFAWLGWYTGMLIPAAIVGLCVFFYG
LFTMNNSQVSQEICKATEVFMCPLCDKNCSLQRLNDSCIYAKVTYLFDNGGTVFFAIFMA
IWATVFLEFWKRRRSILTYTWDLIEWEEEEETLRPQFEAKYYKMEIVNPITGKPEPHQPS
SDKVTRLLVSVSGIFFMISLVITAVFGVVVYRLVVMEQFASFKWNFIKQYWQFATSAAAV
CINFIIIMLLNLAYEKIAYLLTNLEYPRTESEWENSFALKMFLFQFVNLNSSIFYIAFFL
GRFVGHPGKYNKLFDRWRLEECHPSGCLIDLCLQMGVIMFLKQIWNNFMELGYPLIQNWW
SRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIFVAAFPLAPLLAL
LNNIIEIRLDAYKFVTQWRRPLPARATDIGIWLGILEGIGILAVITNAFVIAITSDYIPR
FVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSELGMGKSGYCRYRDYRGPPWSSKPY
EFTLQYWHILAARLAFIIVFEHLVFGIKSFIAYLIPDVPKGLHDRIRREKYLVQEMMYEA
ELEHLQQQRRKSGQPVHHEWP
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggtccaccattcaggctccattcagtcctttaaacagcaaaaaggtatgaatataagc
aagagtgagataacaaaagaaacttcgttaaaaccgtctcggagatccctgccttgcctc
gcccagagctacgcttactcaaagagcttgagccagtctacttccctcttccagtcaacc
gagagtgaatctcaggctcccacatctataaccttaatctccactgacaaagcagagcaa
gttaatactgaggagaataaaaacgactctgtgctgagatgttcatttgctgacctcagc
gatttttgtttggccctaggaaaagataaggattacacggatgaatcagaacacgctact
tatgaccgatctcgtctcattaatgactttgttatcaaagataaatctgaattcaagaca
aaattatctaagaatgacatgaattacatagcatccagtggacctctgttcaaagatggc
aaaaagagaattgattacatcttggtttatagaaagacaaatatacaatatgataaaaga
aacacatttgaaaagaacctcagagcagaaggcttgatgttggagaaggagccagctatt
gcaagccccgatatcatgtttattaaaattcacattccatgggacacgctgtgcaagtat
gcagagaggctgaatatcaggatgcccttcaggaaaaaatgctattacactgacgggagg
agcaaatcaatgggcaggatgcaaacttattttagaagaatcaaaaactggatggcccaa
aacccaatggttcttgacaagtcagcttttccagacctagaggagtcagactgctatact
ggccccttcagccgtgcacggattcaccacttcataataaataataaagacaccttcttc
agcaatgctactcgaagcagaatagtctatcacatgctggaacgcaccaaatatgaaaat
ggaatatcaaaagtgggtatccgtaaacttataaacaatggctcatacatagcagcgttt
ccaccacatgagggagcctacaaaagtagccagcccattaaaacccatggacctcagaat
aacagacatctattatatgagcgctgggcacgctggggaatgtggtataagcatcagcct
ctggatttaatcaggctatactttggtgagaagattggactatactttgcttggctggga
tggtatactggaatgttgattcctgcagcaattgttggtttgtgcgttttcttctatgga
ttatttacaatgaataatagtcaagtaagccaagaaatttgtaaagccactgaagtcttt
atgtgccctctctgtgacaagaactgctccctgcagagactcaacgacagctgtatctat
gccaaggtgacatatttgttcgataatggagggacagtcttctttgctatttttatggca
atatgggccacagtcttcctggagttttggaaaaggagaaggagtatactgacctatact
tgggaccttatcgaatgggaagaagaggaggaaacacttcgtccccagtttgaagccaag
tattacaagatggagattgtaaatcccatcacgggaaaacctgaaccacatcagccttcc
tcagacaaagtcactcgtcttcttgtttctgtctcaggaatattcttcatgatatccttg
gtgatcactgcagtgtttggagttgtggtgtaccgcctggttgtcatggaacagtttgca
tcattcaagtggaatttcatcaaacaatactggcagtttgcaacatctgctgctgctgtc
tgtatcaatttcataatcattatgttgctgaatcttgcttatgaaaaaattgcttacctc
ctcaccaatttagaatatcctcgaacagaatcagagtgggaaaacagcttcgccctgaag
atgttcctcttccagtttgtcaatttaaacagttccatcttctatatcgctttctttttg
ggaagattcgtaggccacccaggaaaatacaataaactttttgaccggtggagactggag
gaatgtcatcctagtggctgtttgatagacctctgcctccagatgggtgtcatcatgttt
ttgaagcaaatatggaacaacttcatggaactaggatacccgttgatccagaactggtgg
tcacgacataaaatcaagcggggaatacatgatgcttccatacctcagtgggaaaatgat
tggaatctgcagcccatgaaccttcatggactgatggatgagtacttagaaatggttttg
caatttggttttaccaccatctttgttgcggcttttcctctagcccctcttttggctttg
ttaaacaatatcattgaaatcaggctggatgcatacaaatttgtcactcaatggcggagg
cctttgccagcccgagcaactgacataggtatctggcttggaattctcgaaggaatcggt
atattggctgtgatcaccaatgcatttgtaattgctattacttctgattacatcccacgt
tttgtttatgaatacaaatatggcccctgtgcaaatcatgtagaaccaagtgaaaattgc
ttgaagggatatgtcaacaatagcctatccttctttgacctgagtgagcttggtatggga
aaatctggttattgcaggtacagagactacagaggcccgccctggagttccaaaccctat
gagtttactttacaatactggcatatccttgctgctagattggccttcattattgtgttt
gagcaccttgtttttgggattaagtcattcatcgcatacctgattccagacgtaccaaag
ggtctacatgaccgaatacgacgagagaagtacttagttcaagaaatgatgtatgaggct
gaactggaacatttgcaacaacaacggagaaaaagtggtcagcctgttcaccatgaatgg
ccttag

DBGET integrated database retrieval system