KEGG   Homo sapiens (human): 6401Help
Entry
6401              CDS       T01001                                 

Gene name
SELE, CD62E, ELAM, ELAM1, ESEL, LECAM2
Definition
(RefSeq) selectin E
  KO
K06494  selectin, endothelial cell
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04668  TNF signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Bimosiamose disodium: D03114
Rivipansel: D10487
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6401 (SELE)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6401 (SELE)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6401 (SELE)
  09167 Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    6401 (SELE)
  09174 Infectious diseases: Parasitic
   05144 Malaria
    6401 (SELE)
   05143 African trypanosomiasis
    6401 (SELE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    6401 (SELE)
   04090 CD molecules [BR:hsa04090]
    6401 (SELE)
   04091 Lectins [BR:hsa04091]
    6401 (SELE)
Cell adhesion molecules [BR:hsa04515]
 Selectins
  Selectin family
   6401 (SELE)
CD molecules [BR:hsa04090]
 Proteins
  6401 (SELE)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 4: Selectins
   6401 (SELE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Lectin_C EGF hEGF EGF_2 EGF_3 Plasmod_Pvs28
Motif
Other DBs
NCBI-GeneID: 6401
NCBI-ProteinID: NP_000441
OMIM: 131210
HGNC: 10718
Ensembl: ENSG00000007908
Vega: OTTHUMG00000034851
Pharos: P16581(Tchem)
UniProt: P16581
Structure
PDB: 

Position
1q24.2
AA seq 610 aa AA seqDB search
MIASQFLSALTLVLLIKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVV
ECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCK
AVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHW
SGLLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCLRKAKKFVPASSCQSLESD
GSYQKPSYIL
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgattgcttcacagtttctctcagctctcactttggtgcttctcattaaagagagtgga
gcctggtcttacaacacctccacggaagctatgacttatgatgaggccagtgcttattgt
cagcaaaggtacacacacctggttgcaattcaaaacaaagaagagattgagtacctaaac
tccatattgagctattcaccaagttattactggattggaatcagaaaagtcaacaatgtg
tgggtctgggtaggaacccagaaacctctgacagaagaagccaagaactgggctccaggt
gaacccaacaataggcaaaaagatgaggactgcgtggagatctacatcaagagagaaaaa
gatgtgggcatgtggaatgatgagaggtgcagcaagaagaagcttgccctatgctacaca
gctgcctgtaccaatacatcctgcagtggccacggtgaatgtgtagagaccatcaataat
tacacttgcaagtgtgaccctggcttcagtggactcaagtgtgagcaaattgtgaactgt
acagccctggaatcccctgagcatggaagcctggtttgcagtcacccactgggaaacttc
agctacaattcttcctgctctatcagctgtgataggggttacctgccaagcagcatggag
accatgcagtgtatgtcctctggagaatggagtgctcctattccagcctgcaatgtggtt
gagtgtgatgctgtgacaaatccagccaatgggttcgtggaatgtttccaaaaccctgga
agcttcccatggaacacaacctgtacatttgactgtgaagaaggatttgaactaatggga
gcccagagccttcagtgtacctcatctgggaattgggacaacgagaagccaacgtgtaaa
gctgtgacatgcagggccgtccgccagcctcagaatggctctgtgaggtgcagccattcc
cctgctggagagttcaccttcaaatcatcctgcaacttcacctgtgaggaaggcttcatg
ttgcagggaccagcccaggttgaatgcaccactcaagggcagtggacacagcaaatccca
gtttgtgaagctttccagtgcacagccttgtccaaccccgagcgaggctacatgaattgt
cttcctagtgcttctggcagtttccgttatgggtccagctgtgagttctcctgtgagcag
ggttttgtgttgaagggatccaaaaggctccaatgtggccccacaggggagtgggacaac
gagaagcccacatgtgaagctgtgagatgcgatgctgtccaccagcccccgaagggtttg
gtgaggtgtgctcattcccctattggagaattcacctacaagtcctcttgtgccttcagc
tgtgaggagggatttgaattacatggatcaactcaacttgagtgcacatctcagggacaa
tggacagaagaggttccttcctgccaagtggtaaaatgttcaagcctggcagttccggga
aagatcaacatgagctgcagtggggagcccgtgtttggcactgtgtgcaagttcgcctgt
cctgaaggatggacgctcaatggctctgcagctcggacatgtggagccacaggacactgg
tctggcctgctacctacctgtgaagctcccactgagtccaacattcccttggtagctgga
ctttctgctgctggactctccctcctgacattagcaccatttctcctctggcttcggaaa
tgcttacggaaagcaaagaaatttgttcctgccagcagctgccaaagccttgaatcagat
ggaagctaccaaaagccttcttacatcctttaa

DBGET integrated database retrieval system