KEGG   Homo sapiens (human): 6402Help
Entry
6402              CDS       T01001                                 

Gene name
SELL, CD62L, LAM1, LECAM1, LEU8, LNHR, LSEL, LYAM1, PLNHR, TQ1
Definition
(RefSeq) selectin L
  KO
K06495  selectin, lymphocyte
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
Drug target
Bimosiamose disodium: D03114
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6402 (SELL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    6402 (SELL)
   04090 CD molecules [BR:hsa04090]
    6402 (SELL)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6402 (SELL)
   04091 Lectins [BR:hsa04091]
    6402 (SELL)
Cell adhesion molecules [BR:hsa04515]
 Selectins
  Selectin family
   6402 (SELL)
CD molecules [BR:hsa04090]
 Proteins
  6402 (SELL)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   6402 (SELL)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 4: Selectins
   6402 (SELL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Sushi EGF hEGF EGF_2 EGF_3
Motif
Other DBs
NCBI-GeneID: 6402
NCBI-ProteinID: NP_000646
OMIM: 153240
HGNC: 10720
Ensembl: ENSG00000188404
Vega: OTTHUMG00000034809
Pharos: P14151(Tchem)
UniProt: P14151
Structure
PDB: 

Position
1q24.2
AA seq 372 aa AA seqDB search
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDN
YTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPN
NKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTC
NCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETT
CGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKK
TICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKK
GKKSKRSMNDPY
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgatatttccatggaaatgtcagagcacccagagggacttatggaacatcttcaagttg
tgggggtggacaatgctctgttgtgatttcctggcacatcatggaaccgactgctggact
taccattattctgaaaaacccatgaactggcaaagggctagaagattctgccgagacaat
tacacagatttagttgccatacaaaacaaggcggaaattgagtatctggagaagactctg
cctttcagtcgttcttactactggataggaatccggaagataggaggaatatggacgtgg
gtgggaaccaacaaatctcttactgaagaagcagagaactggggagatggtgagcccaac
aacaagaagaacaaggaggactgcgtggagatctatatcaagagaaacaaagatgcaggc
aaatggaacgatgacgcctgccacaaactaaaggcagccctctgttacacagcttcttgc
cagccctggtcatgcagtggccatggagaatgtgtagaaatcatcaataattacacctgc
aactgtgatgtggggtactatgggccccagtgtcagtttgtgattcagtgtgagcctttg
gaggccccagagctgggtaccatggactgtactcaccctttgggaaacttcagcttcagc
tcacagtgtgccttcagctgctctgaaggaacaaacttaactgggattgaagaaaccacc
tgtggaccatttggaaactggtcatctccagaaccaacctgtcaagtgattcagtgtgag
cctctatcagcaccagatttggggatcatgaactgtagccatcccctggccagcttcagc
tttacctctgcatgtaccttcatctgctcagaaggaactgagttaattgggaagaagaaa
accatttgtgaatcatctggaatctggtcaaatcctagtccaatatgtcaaaaattggac
aaaagtttctcaatgattaaggagggtgattataaccccctcttcattccagtggcagtc
atggttactgcattctctgggttggcatttatcatttggctggcaaggagattaaaaaaa
ggcaagaaatccaagagaagtatgaatgacccatattaa

DBGET integrated database retrieval system