KEGG   Homo sapiens (human): 6404Help
Entry
6404              CDS       T01001                                 

Gene name
SELPLG, CD162, CLA, PSGL-1, PSGL1
Definition
(RefSeq) selectin P ligand
  KO
K06544  selectin P ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    6404 (SELPLG)
 09160 Human Diseases
  09167 Infectious diseases
   05150 Staphylococcus aureus infection
    6404 (SELPLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    6404 (SELPLG)
CD molecules [BR:hsa04090]
 Proteins
  6404 (SELPLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4689 Cadherin_C_2
Motif
Other DBs
NCBI-GeneID: 6404
NCBI-ProteinID: NP_002997
OMIM: 600738
HGNC: 10722
Ensembl: ENSG00000110876
Vega: OTTHUMG00000169411
Pharos: Q14242(Tbio)
UniProt: Q14242
Position
12q24.11
AA seq 412 aa AA seqDB search
MPLQLLLLLILLGPGNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPP
EMLRNSTDTTPLTGPGTPESTTVEPAARRSTGLDAGGAVTELTTELANMGNLSTDSAAME
IQTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATE
AQTTQPTGLEAQTTAPAAMEAQTTAPAAMEAQTTPPAAMEAQTTQTTAMEAQTTAPEATE
AQTTQPTATEAQTTPLAAMEALSTEPSATEALSMEPTTKRGLFIPFSVSSVTHKGIPMAA
SNLSVNYPVGAPDHISVKQCLLAILILALVATIFFVCTVVLAVRLSRKGHMYPVRNYSPT
EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSFLP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgcaactcctcctgttgctgatcctactgggccctggcaacagcttgcagctg
tgggacacctgggcagatgaagccgagaaagccttgggtcccctgcttgcccgggaccgg
agacaggccaccgaatatgagtacctagattatgatttcctgccagaaacggagcctcca
gaaatgctgaggaacagcactgacaccactcctctgactgggcctggaacccctgagtct
accactgtggagcctgctgcaaggcgttctactggcctggatgcaggaggggcagtcaca
gagctgaccacggagctggccaacatggggaacctgtccacggattcagcagctatggag
atacagaccactcaaccagcagccacggaggcacagaccactcaaccagtgcccacggag
gcacagaccactccactggcagccacagaggcacagacaactcgactgacggccacggag
gcacagaccactccactggcagccacagaggcacagaccactccaccagcagccacggaa
gcacagaccactcaacccacaggcctggaggcacagaccactgcaccagcagccatggag
gcacagaccactgcaccagcagccatggaagcacagaccactccaccagcagccatggag
gcacagaccactcaaaccacagccatggaggcacagaccactgcaccagaagccacggag
gcacagaccactcaacccacagccacggaggcacagaccactccactggcagccatggag
gccctgtccacagaacccagtgccacagaggccctgtccatggaacctactaccaaaaga
ggtctgttcatacccttttctgtgtcctctgttactcacaagggcattcccatggcagcc
agcaatttgtccgtcaactacccagtgggggccccagaccacatctctgtgaagcagtgc
ctgctggccatcctaatcttggcgctggtggccactatcttcttcgtgtgcactgtggtg
ctggcggtccgcctctcccgcaagggccacatgtaccccgtgcgtaattactcccccacc
gagatggtctgcatctcatccctgttgcctgatgggggtgaggggccctctgccacagcc
aatgggggcctgtccaaggccaagagcccgggcctgacgccagagcccagggaggaccgt
gagggggatgacctcaccctgcacagcttcctcccttag

DBGET integrated database retrieval system