KEGG   Homo sapiens (human): 6405Help
Entry
6405              CDS       T01001                                 

Gene name
SEMA3F, SEMA-IV, SEMA4, SEMAK
Definition
(RefSeq) semaphorin 3F
  KO
K06840  semaphorin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    6405 (SEMA3F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sema Ig_3 I-set ig V-set PSI Ig_2
Motif
Other DBs
NCBI-GeneID: 6405
NCBI-ProteinID: NP_004177
OMIM: 601124
HGNC: 10728
Ensembl: ENSG00000001617
Vega: OTTHUMG00000156806
Pharos: Q13275(Tbio)
UniProt: Q13275
Position
3p21.31
AA seq 785 aa AA seqDB search
MLVAGLLLWASLLTGAWPSFPTQDHLPATPRVRLSFKELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDVNGECGNFVR
LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQAVRGRGSRATDGALRPMPTA
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNDPSFIHAELIPDSAERNDDKLYFFFRERSAEAPQSPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTIAVDQVDAADGRYEV
LFLGTDRGTVQKVIVLPKDDQELEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
FNSNANKNAVESVQYGVAGSAAFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTE
QGLLLRALQLSDRGLYSCTATENNFKHVVTRVQLHVLGRDAVHAALFPPLSMSAPPPPGA
GPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRSPEPQDQKKPRNRRH
HPPDT
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcgccggtcttcttctctgggcttccctactgaccggggcctggccatccttc
cccacccaggaccacctcccggccacgccccgggtccggctctcattcaaagagctgaag
gccacaggcaccgcccacttcttcaacttcctgctcaacacaaccgactaccgaatcttg
ctcaaggacgaggaccacgaccgcatgtacgtgggcagcaaggactacgtgctgtccctg
gacctgcacgacatcaaccgcgagcccctcattatacactgggcagcctccccacagcgc
atcgaggaatgcgtgctctcaggcaaggatgtcaacggcgagtgtgggaacttcgtcagg
ctcatccagccctggaaccgaacacacctgtatgtgtgcgggacaggtgcctacaacccc
atgtgcacctatgtgaaccgcggacgccgcgcccaggccacaccatggacccagactcag
gcggtcagaggccgcggcagcagagccacggatggtgccctccgcccgatgcccacagcc
ccacgccaggattacatcttctacctggagcctgagcgactcgagtcagggaagggcaag
tgtccgtacgatcccaagctggacacagcatcggccctcatcaatgaggagctctatgct
ggtgtgtacatcgattttatgggcactgatgcagccatcttccgcacacttggaaagcag
acagccatgcgcacggatcagtacaactcccggtggctgaacgacccgtcgttcatccat
gctgagctcattcctgacagtgcggagcgcaatgatgataagctttacttcttcttccgt
gagcggtcggcagaggcgccgcagagccccgcggtgtacgcccgcatcgggcgcatttgc
ctgaacgatgacggtggtcactgttgcctggtcaacaagtggagcacattcctgaaggcg
cggctcgtctgctctgtcccgggcgaggatggcattgagactcactttgatgagctccag
gacgtgtttgtccagcagacccaggacgtgaggaaccctgtcatttacgctgtctttacc
tcctctggctccgtgttccgaggctctgccgtgtgtgtctactccatggctgatattcgc
atggtcttcaacgggccctttgcccacaaagaggggcccaactaccagtggatgcccttc
tcagggaagatgccctacccacggccgggcacgtgccctggtggaaccttcacgccatct
atgaagtccaccaaggattatcctgatgaggtgatcaacttcatgcgcagccacccactc
atgtaccaggccgtgtaccctctgcagcggcggcccctggtagtccgcacaggtgctccc
taccgccttaccactattgccgtggaccaggtggatgcagccgacgggcgctatgaggtg
cttttcctgggcacagaccgcgggacagtgcagaaggtcattgtgctgcccaaggatgac
caggagttggaggagctcatgctggaggaggtggaggtcttcaaggatccagcacccgtc
aagaccatgaccatctcttctaagaggcaacaactctacgtggcgtcagccgtgggtgtc
acacacctgagcctgcaccgctgccaggcgtatggggctgcctgtgctgactgctgcctt
gcccgggacccttactgtgcctgggatggccaggcctgctcccgctatacagcatcctcc
aagaggcggagccgccggcaggacgtccggcacggaaaccccatcaggcagtgccgtggg
ttcaactccaatgccaacaagaatgccgtggagtctgtgcagtatggcgtggccggcagc
gcagccttccttgagtgccagccccgctcgccccaagccactgttaagtggctgttccag
cgagatcctggtgaccggcgccgagagattcgtgcagaggaccgcttcctgcgcacagag
cagggcttgttgctccgtgcactgcagctcagcgatcgtggcctctactcctgcacagcc
actgagaacaactttaagcacgtcgtcacacgagtgcagctgcatgtactgggccgggac
gccgtccatgctgccctcttcccaccactgtccatgagcgccccgccacccccaggcgca
ggccccccaacgcctccttaccaggagttagcccagctgctggcccagccagaagtgggc
ctcatccaccagtactgccagggttactggcgccatgtgccccccagccccagggaggct
ccaggggcaccccggtctcctgagccccaggaccagaaaaagccccggaaccgccggcac
caccctccggacacatga

DBGET integrated database retrieval system