KEGG   Homo sapiens (human): 64063Help
Entry
64063             CDS       T01001                                 

Gene name
PRSS22, BSSP-4, SP001LA, hBSSP-4
Definition
(RefSeq) serine protease 22
  KO
K09626  brain-specific serine protease 4 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    64063 (PRSS22)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     64063 (PRSS22)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   64063 (PRSS22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 64063
NCBI-ProteinID: NP_071402
OMIM: 609343
HGNC: 14368
Ensembl: ENSG00000005001
Vega: OTTHUMG00000128961
Pharos: Q9GZN4(Tdark)
UniProt: Q9GZN4
Position
16p13.3
AA seq 317 aa AA seqDB search
MVVSGAPPALGGGCLGTFTSLLLLASTAILNAARIPVPPACGKPQQLNRVVGGEDSTDSE
WPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGNPGSRSQK
VGVAWVEPHPVYSWKEGACADIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGW
GSIQDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLG
DSGGPLMCQVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIVQGVQLRGRAQG
GGALRAPSQGSGAAARS
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggtggtttctggagcgcccccagccctgggtgggggctgtctcggcaccttcacctcc
ctgctgctgctggcgtcgacagccatcctcaatgcggccaggatacctgttcccccagcc
tgtgggaagccccagcagctgaaccgggttgtgggcggcgaggacagcactgacagcgag
tggccctggatcgtgagcatccagaagaatgggacccaccactgcgcaggttctctgctc
accagccgctgggtgatcactgctgcccactgtttcaaggacaacctgaacaaaccatac
ctgttctctgtgctgctgggggcctggcagctggggaaccctggctctcggtcccagaag
gtgggtgttgcctgggtggagccccaccctgtgtattcctggaaggaaggtgcctgtgca
gacattgccctggtgcgtctcgagcgctccatacagttctcagagcgggtcctgcccatc
tgcctacctgatgcctctatccacctccctccaaacacccactgctggatctcaggctgg
gggagcatccaagatggagttcccttgccccaccctcagaccctgcagaagctgaaggtt
cctatcatcgactcggaagtctgcagccatctgtactggcggggagcaggacagggaccc
atcactgaggacatgctgtgtgccggctacttggagggggagcgggatgcttgtctgggc
gactccgggggccccctcatgtgccaggtggacggcgcctggctgctggccggcatcatc
agctggggcgagggctgtgccgagcgcaacaggcccggggtctacatcagcctctctgcg
caccgctcctgggtggagaagatcgtgcaaggggtgcagctccgcgggcgcgctcagggg
ggtggggccctcagggcaccgagccagggctctggggccgccgcgcgctcctag

DBGET integrated database retrieval system