KEGG   Homo sapiens (human): 64064Help
Entry
64064             CDS       T01001                                 

Gene name
OXCT2, FKSG25, SCOTT
Definition
(RefSeq) 3-oxoacid CoA-transferase 2
  KO
K01027  3-oxoacid CoA-transferase [EC:2.8.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00072  Synthesis and degradation of ketone bodies
hsa00280  Valine, leucine and isoleucine degradation
hsa00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    64064 (OXCT2)
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    64064 (OXCT2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    64064 (OXCT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     64064 (OXCT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-GeneID: 64064
NCBI-ProteinID: NP_071403
OMIM: 610289
HGNC: 18606
Ensembl: ENSG00000198754
Vega: OTTHUMG00000009249
Pharos: Q9BYC2(Tbio)
UniProt: Q9BYC2
Position
1p34.2
AA seq 517 aa AA seqDB search
MAALRLLASVLGRGVPAGGSGLALSQGCARCFATSPRLRAKFYADPVEMVKDISDGATVM
IGGFGLCGIPENLIAALLRTRVKDLQVVSSNVGVEDFGLGLLLAARQVRRIVCSYVGENT
LCESQYLAGELELELTPQGTLAERIRAGGAGVPAFYTPTGYGTLVQEGGAPIRYTPDGHL
ALMSQPREVREFNGDHFLLERAIRADFALVKGWKADRAGNVVFRRSARNFNVPMCKAADV
TAVEVEEIVEVGAFPPEDIHVPNIYVDRVIKGQKYEKRIERLTILKEEDGDAGKEEDART
RIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPFPTEDEVDADL
INAGKQTVTVLPGGCFFASDDSFAMIRGGHIQLTMLGAMQVSKYGDLANWMIPGKKVKGM
GGAMDLVSSQKTRVVVTMQHCTKDNTPKIMEKCTMPLTGKRCVDRIITEKAVFDVHRKKE
LTLRELWEGLTVDDIKKSTGCAFAVSPNLRPMQQVAP
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctgcggctcctggcgtcagtgctcgggcgcggggtccccgccggcggctca
gggctcgcgctgtcccagggctgcgcccgctgctttgccaccagtccccggctccgtgcc
aagttctacgcggacccggtggagatggtgaaggacatctctgacggggcgaccgtcatg
atcgggggcttcgggctctgcgggatccccgagaacctgatcgccgcgctgctcaggacc
cgcgtgaaagacctgcaggtggtcagcagcaacgtgggcgtggaggacttcggcctgggc
ctcctgctggccgccaggcaggtccgtcgcatcgtctgttcctacgtgggcgagaacacc
ctgtgcgagagccagtacctggcaggagagctggagctggagctcacgccccagggcacc
ctggccgagcgcatccgcgcggggggcgccggggtgcccgccttctacacccccacgggc
tacgggaccctggtccaggaagggggcgcccccatccgctacaccccggacggccacctg
gcgctcatgagccagccccgagaggtgagggagttcaacggcgaccacttccttttggag
cgcgccatccgggcagacttcgccctggtgaaagggtggaaggccgaccgggcaggaaac
gtggtcttcaggagaagcgcccgcaatttcaacgtgcccatgtgcaaagctgcagacgtc
acggcggtggaggtggaagagatcgtggaggtgggggctttccccccagaagacatccac
gttcctaacatttatgtagatcgcgtgataaaggggcagaaatacgagaaacgaattgag
cgcttaacgatcctgaaagaggaagatggagacgctggaaaggaagaggacgccaggacg
cgcatcatcagacgcgcagctctggaatttgaggacggcatgtacgccaatctgggcata
ggcatccccctgctggccagcaacttcatcagtcccagcatgactgtccatcttcacagt
gagaacgggatcctgggcctgggcccgtttcccacggaagatgaggtggatgccgacctc
atcaatgcaggcaagcagacggtcacggtgcttcccgggggctgcttcttcgccagcgac
gactccttcgccatgatccgagggggacacatccaactaaccatgcttggagccatgcag
gtttccaaatacggcgacctggcgaactggatgatccctggcaagaaggtgaaaggcatg
ggcggtgccatggacttggtgtccagtcagaagaccagagtggtggtcaccatgcagcac
tgcacaaaggacaacacccccaagatcatggagaaatgcaccatgccgctgaccgggaag
cggtgcgtggaccgcatcatcaccgagaaggccgtgtttgacgtgcacaggaagaaagag
ctgacgctgagggagctctgggagggcctgacggtggacgacatcaaaaagagcacgggg
tgtgcctttgctgtgtccccgaacctcaggcccatgcagcaggtggcaccctga

DBGET integrated database retrieval system