KEGG   Homo sapiens (human): 64065Help
Entry
64065             CDS       T01001                                 

Gene name
PERP, KCP1, KRTCAP1, PIGPC1, THW, dJ496H19.1
Definition
(RefSeq) p53 apoptosis effector related to PMP22
  KO
K10136  TP53 apoptosis effector
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    64065 (PERP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 64065
NCBI-ProteinID: NP_071404
OMIM: 609301
HGNC: 17637
Ensembl: ENSG00000112378
Vega: OTTHUMG00000015668
Pharos: Q96FX8(Tbio)
UniProt: Q96FX8
Position
6q23.3
AA seq 193 aa AA seqDB search
MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGS
YEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAV
FQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDL
LGNAKPRYFYTSA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctgcggcctggcctgcgagcgctgccgctggatcctgcccctgctcctactc
agcgccatcgccttcgacatcatcgcgctggccggccgcggctggttgcagtctagcgac
cacggccagacgtcctcgctgtggtggaaatgctcccaagagggcggcggcagcgggtcc
tacgaggagggctgtcagagcctcatggagtacgcgtggggtagagcagcggctgccatg
ctcttctgtggcttcatcatcctggtgatctgtttcatcctctccttcttcgccctctgt
ggaccccagatgcttgtcttcctgagagtgattggaggtctccttgccttggctgctgtg
ttccagatcatctccctggtaatttaccccgtgaagtacacccagaccttcacccttcat
gccaaccctgctgtcacttacatctataactgggcctacggctttgggtgggcagccacg
attatcctgattggctgtgccttcttcttctgctgcctccccaactacgaagatgacctt
ctgggcaatgccaagcccaggtacttctacacatctgcctaa

DBGET integrated database retrieval system