KEGG   Homo sapiens (human): 6407Help
Entry
6407              CDS       T01001                                 

Gene name
SEMG2, SGII
Definition
(RefSeq) semenogelin 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Semenogelin
Motif
Other DBs
NCBI-GeneID: 6407
NCBI-ProteinID: NP_002999
OMIM: 182141
HGNC: 10743
Ensembl: ENSG00000124157
Vega: OTTHUMG00000032566
Pharos: Q02383(Tbio)
UniProt: Q02383
Position
20q13.12
AA seq 582 aa AA seqDB search
MKSIILFVLSLLLILEKQAAVMGQKGGSKGQLPSGSSQFPHGQKGQHYFGQKDQQHTKSK
GSFSIQHTYHVDINDHDWTRKSQQYDLNALHKATKSKQHLGGSQQLLNYKQEGRDHDKSK
GHFHMIVIHHKGGQAHHGTQNPSQDQGNSPSGKGLSSQCSNTEKRLWVHGLSKEQASASG
AQKGRTQGGSQSSYVLQTEELVVNKQQRETKNSHQNKGHYQNVVDVREEHSSKLQTSLHP
AHQDRLQHGPKDIFTTQDELLVYNKNQHQTKNLSQDQEHGRKAHKISYPSSRTEERQLHH
GEKSVQKDVSKGSISIQTEEKIHGKSQNQVTIHSQDQEHGHKENKISYQSSSTEERHLNC
GEKGIQKGVSKGSISIQTEEQIHGKSQNQVRIPSQAQEYGHKENKISYQSSSTEERRLNS
GEKDVQKGVSKGSISIQTEEKIHGKSQNQVTIPSQDQEHGHKENKMSYQSSSTEERRLNY
GGKSTQKDVSQSSISFQIEKLVEGKSQIQTPNPNQDQWSGQNAKGKSGQSADSKQDLLSH
EQKGRYKQESSESHNIVITEHEVAQDDHLTQQYNEDRNPIST
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccatcatcctctttgtcctttccctgctccttatcttggagaagcaagcagct
gtgatgggacaaaaaggtggatcaaaaggccaattgccaagcggatcttcccaatttcca
catggacaaaagggccagcactattttggacaaaaagaccaacaacatactaaatccaaa
ggcagtttttctattcaacacacatatcatgtagacatcaatgatcatgactggacccga
aaaagtcagcaatatgatttgaatgccctacataaggcgacaaaatcaaaacaacaccta
ggtggaagtcaacaactgctcaattataaacaagaaggcagagaccatgataaatcaaaa
ggtcattttcacatgatagttatacatcataaaggaggccaagctcatcatgggacacaa
aatccttctcaagatcaggggaatagcccatctggaaagggattatccagtcaatgttca
aacacagaaaaaaggctatgggttcatggactaagtaaagaacaagcttcagcctctggt
gcacaaaaaggtagaacacaaggtggatcccaaagcagttatgttctccaaactgaagaa
ctagtagttaacaaacaacaacgtgagactaaaaattctcatcaaaataaagggcattac
caaaatgtggttgacgtgagagaggaacattcaagtaaactacaaacttcactccatcct
gcacatcaagacagactccaacatggacccaaagacatttttactacccaagatgagctc
ctagtatataacaagaatcaacaccagacaaaaaatctcagtcaagatcaagagcatggc
cggaaggcacataaaatatcatacccgtcttcacgtacagaagaaagacaacttcaccat
ggagaaaagagtgtacagaaagatgtatccaaaggcagcatttctatccaaactgaagag
aaaatacatggcaagtctcaaaaccaggtaacaattcatagtcaagatcaagagcatggc
cataaggaaaataaaatatcataccaatcttcaagtacagaagaaagacatctcaactgt
ggagaaaagggcatccagaaaggtgtatccaaaggcagtatttcgatccaaactgaagag
caaatacatggcaagtctcaaaaccaggtaagaattcctagtcaagctcaagagtatggc
cataaggaaaataaaatatcataccaatcttcgagtacagaagaaagacgtctcaacagt
ggagaaaaggatgtacagaaaggtgtatccaaaggcagtatttctatccaaactgaagag
aaaatacatggcaagtctcaaaaccaggtaacaattcctagtcaagatcaagagcatggc
cataaggaaaataaaatgtcataccaatcttcaagtacagaagaaagacgactcaactat
ggaggaaagagcacgcagaaagatgtatcccaaagcagtatttctttccaaattgaaaag
ctagtagaaggcaagtctcaaatccagacaccaaatcctaatcaagatcaatggtctggc
caaaatgcaaaaggaaagtctggtcaatctgcagatagcaaacaagacctactcagtcat
gaacaaaaaggcagatacaaacaggaatccagtgagtcacataatattgtaattactgag
catgaggttgcccaagatgatcatttgacacaacaatataatgaagacagaaatccaata
tctacatag

DBGET integrated database retrieval system