KEGG   Homo sapiens (human): 64077Help
Entry
64077             CDS       T01001                                 

Gene name
LHPP, HDHD2B
Definition
(RefSeq) phospholysine phosphohistidine inorganic pyrophosphate phosphatase
  KO
K11725  phospholysine phosphohistidine inorganic pyrophosphate phosphatase [EC:3.6.1.1 3.1.3.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    64077 (LHPP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    64077 (LHPP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     64077 (LHPP)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.1  inorganic diphosphatase
     64077 (LHPP)
Protein phosphatases and associated proteins [BR:hsa01009]
 HAD phosphatases
  Other HAD phosphatases
   64077 (LHPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 Hydrolase HAD_2 Nuf2
Motif
Other DBs
NCBI-GeneID: 64077
NCBI-ProteinID: NP_071409
OMIM: 617231
HGNC: 30042
Ensembl: ENSG00000107902
Vega: OTTHUMG00000019214
Pharos: Q9H008(Tbio)
UniProt: Q9H008
Structure
PDB: 

Position
10q26.13
AA seq 270 aa AA seqDB search
MAPWGKRLAGVRGVLLDISGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFCTNESQKS
RAELVGQLQRLGFDISEQEVTAPAPAACQILKEQGLRPYLLIHDGVRSEFDQIDTSNPNC
VVIADAGESFSYQNMNNAFQVLMELEKPVLISLGKGRYYKETSGLMLDVGPYMKALEYAC
GIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMRALQVRTGKFRP
SDEHHPEVKADGYVDNLAEAVDLLLQHADK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgtggggcaagcggctggctggcgtgcgcggggtgctgcttgacatctcgggc
gtgctgtacgacagcggcgcgggcggcggcacggccatcgccggctcggtggaggcggtg
gccagactgaagcgttcccggctgaaggtgaggttctgcaccaacgagtcgcagaagtcc
cgggcagagctggtggggcagcttcagaggctgggatttgacatctctgagcaggaggtg
accgccccggcaccagctgcctgccagatcctgaaggagcaaggcctgcgaccatacctg
ctcatccatgacggagtccgctcagaatttgatcagatcgacacatccaacccaaactgt
gtggtaattgcagacgcaggagaaagcttttcttatcaaaacatgaataacgccttccag
gtgctcatggagctggaaaaacctgtgctcatatcactgggaaaagggcgttactacaag
gagacctctggcctgatgctggacgttggtccctacatgaaggcgcttgagtatgcctgt
ggcatcaaagccgaggtggtggggaagccttctcctgagtttttcaagtctgccctgcaa
gcgataggagtggaagcccaccaggccgtcatgattggggacgatatcgtgggcgacgtc
ggcggtgcccagcggtgtggaatgagagcgctgcaggtgcgcaccgggaagttcaggccc
agtgacgagcaccatccggaagtgaaggctgatgggtacgtggacaacctcgcagaggca
gtggacctgctgctgcagcacgccgacaagtga

DBGET integrated database retrieval system