KEGG   Homo sapiens (human): 64090Help
Entry
64090             CDS       T01001                                 

Gene name
GAL3ST2, GAL3ST-2, GP3ST
Definition
(RefSeq) galactose-3-O-sulfotransferase 2
  KO
K09675  galactose-3-O-sulfotransferase 2 [EC:2.8.2.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    64090 (GAL3ST2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     64090 (GAL3ST2)
Glycosyltransferases [BR:hsa01003]
 Unclassified
  Sulfotransferases
   64090 (GAL3ST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-3-0_sulfotr Sulfotransfer_2
Motif
Other DBs
NCBI-GeneID: 64090
NCBI-ProteinID: NP_071417
OMIM: 608237
HGNC: 24869
Ensembl: ENSG00000154252
Vega: OTTHUMG00000151473
Pharos: Q9H3Q3(Tdark)
UniProt: Q9H3Q3
Position
2q37.3
AA seq 398 aa AA seqDB search
MMSMLGGLQRYFRVILLLLLALTLLLLAGFLHSDLELDTPLFGGQAEGPPVTNIMFLKTH
KTASSTVLNILYRFAETHNLSVALPAGSRVHLGYPWLFLARYVEGVGSQQRFNIMCNHLR
FNLPQVQKVMPNDTFYFSILRNPVFQLESSFIYYKTYAPAFRGAPSLDAFLASPRTFYND
SRHLRNVYAKNNMWFDFGFDPNAQCEEGYVRARIAEVERRFRLVLIAEHLDESLVLLRRR
LRWALDDVVAFRLNSRSARSVARLSPETRERARSWCALDWRLYEHFNRTLWAQLRAELGP
RRLRGEVERLRARRRELASLCLQDGGALKNHTQIRDPRLRPYQSGKADILGYNLRPGLDN
QTLGVCQRLVMPELQYMARLYALQFPEKPLKNIPFLGA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccatgctgggcggcttgcagagatacttccgggtcatcctcctcctcctcctg
gccctgactctgctcctgctggccggattcctgcactcggacttagagctggacacaccc
ctgtttgggggccaggctgaggggccgccggtcaccaacatcatgttcctgaagacgcac
aagacggccagcagcacggtgctcaacatcctctaccgcttcgccgagacccacaacctg
tccgtggcgctgcccgccggctcacgcgtccacctgggctacccctggctcttcctggcg
cgctacgtggaaggcgtggggtcgcagcagcgcttcaacatcatgtgcaaccacctgagg
ttcaacctgcctcaggtgcagaaagtcatgcccaacgacaccttctacttctccatcctg
aggaaccccgtgttccagctggagtcctccttcatctactacaaaacctacgcccccgcc
ttccggggcgccccgagcctggacgcgttcctggcctcgccgcggacgttctacaacgac
agccgccacctcaggaacgtctacgccaagaacaacatgtggttcgacttcggcttcgac
cccaacgcgcagtgcgaggagggctacgtgcgcgcgcgcatcgccgaggtggagcggcgc
ttccggctggtgctcatcgccgagcacctggacgagtccctggtgctgctgcggcgccgg
ctgcgctgggcgctggacgacgtggtggccttcaggctcaactcccgcagcgcgcgctcc
gtggcccgcctgtcgcccgagacccgggagcgcgcgcggagctggtgcgcgctggactgg
cgcctgtacgagcatttcaaccgcaccctctgggcgcagctgcgcgccgagctggggccg
cggcggctgcgcggggaggtggagcggctgcgcgcccggaggcgcgaactcgcgagcctg
tgcctgcaggacggcggcgcgctcaagaaccacacgcagatcagagacccgcgcctgcgc
ccctaccagtccggcaaggccgacatcctgggttacaacctccggccgggcctggacaac
cagacgctgggcgtgtgccagaggcttgtgatgcctgagctccagtacatggcccgcctg
tacgccctgcagttcccggagaagcccctcaagaacatcccgttcctgggggcgtag

DBGET integrated database retrieval system