KEGG   Homo sapiens (human): 64093Help
Entry
64093             CDS       T01001                                 

Gene name
SMOC1, OAS
Definition
(RefSeq) SPARC related modular calcium binding 1
Organism
hsa  Homo sapiens (human)
Disease
H02134  Microphthalmia with limb anomalies
SSDB OrthologParalogGFIT
Motif
Pfam: Thyroglobulin_1 Thyroglob_assoc SPARC_Ca_bdg Kazal_2 EF-hand_7 Kazal_1
Motif
Other DBs
NCBI-GeneID: 64093
NCBI-ProteinID: NP_071420
OMIM: 608488
HGNC: 20318
Ensembl: ENSG00000198732
Vega: OTTHUMG00000171237
Pharos: Q9H4F8(Tbio)
UniProt: Q9H4F8 A0A024R6E0
Position
14q24.2
AA seq 434 aa AA seqDB search
MLPARCARLLTPHLLLVLVQLSPARGHRTTGPRFLISDRDPQCNLHCSRTQPKPICASDG
RSYESMCEYQRAKCRDPTLGVVHRGRCKDAGQSKCRLERAQALEQAKKPQEAVFVPECGE
DGSFTQVQCHTYTGYCWCVTPDGKPISGSSVQNKTPVCSGSVTDKPLSQGNSGRKDDGSK
PTPTMETQPVFDGDEITAPTLWIKHLVIKDSKLNNTNIRNSEKVYSCDQERQSALEEAQQ
NPREGIVIPECAPGGLYKPVQCHQSTGYCWCVLVDTGRPLPGTSTRYVMPSCESDARAKT
TEADDPFKDRELPGCPEGKKMEFITSLLDALTTDMVQAINSAAPTGGGRFSEPDPSHTLE
ERVVHWYFSQLDSNSSNDINKREMKPFKRYVKKKAKPKKCARRFTDYCDLNKDKVISLPE
LKGCLGVSKEGRLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgcgcgctgcgcccgcctgctcacgccccacttgctgctggtgttggtgcag
ctgtcccctgctcgcggccaccgcaccacaggccccaggtttctaataagtgaccgtgac
ccacagtgcaacctccactgctccaggactcaacccaaacccatctgtgcctctgatggc
aggtcctacgagtccatgtgtgagtaccagcgagccaagtgccgagacccgaccctgggc
gtggtgcatcgaggtagatgcaaagatgctggccagagcaagtgtcgcctggagcgggct
caagccctggagcaagccaagaagcctcaggaagctgtgtttgtcccagagtgtggcgag
gatggctcctttacccaggtgcagtgccatacttacactgggtactgctggtgtgtcacc
ccggatgggaagcccatcagtggctcttctgtgcagaataaaactcctgtatgttcaggt
tcagtcaccgacaagcccttgagccagggtaactcaggaaggaaagatgacgggtctaag
ccgacacccacgatggagacccagccggtgttcgatggagatgaaatcacagccccaact
ctatggattaaacacttggtgatcaaggactccaaactgaacaacaccaacataagaaat
tcagagaaagtctattcgtgtgaccaggagaggcagagtgccctggaagaggcccagcag
aatccccgtgagggtattgtcatccctgaatgtgcccctgggggactctataagccagtg
caatgccaccagtccactggctactgctggtgtgtgctggtggacacagggcgcccgctg
cctgggacctccacacgctacgtgatgcccagttgtgagagcgacgccagggccaagact
acagaggcggatgaccccttcaaggacagggagctaccaggctgtccagaagggaagaaa
atggagtttatcaccagcctactggatgctctcaccactgacatggttcaggccattaac
tcagcagcgcccactggaggtgggaggttctcagagccagaccccagccacaccctggag
gagcgggtagtgcactggtatttcagccagctggacagcaatagcagcaacgacattaac
aagcgggagatgaagcccttcaagcgctacgtgaagaagaaagccaagcccaagaaatgt
gcccggcgtttcaccgactactgtgacctgaacaaagacaaggtcatttcactgcctgag
ctgaagggctgcctgggtgttagcaaagaaggacgcctcgtctaa

DBGET integrated database retrieval system