KEGG   Homo sapiens (human): 64096Help
Entry
64096             CDS       T01001                                 

Gene name
GFRA4
Definition
(RefSeq) GDNF family receptor alpha 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GDNF
Motif
Other DBs
NCBI-GeneID: 64096
NCBI-ProteinID: NP_665705
HGNC: 13821
Ensembl: ENSG00000125861
Vega: OTTHUMG00000031748
Pharos: Q9GZZ7(Tdark)
UniProt: Q9GZZ7
Position
20p13
AA seq 299 aa AA seqDB search
MVRCLGPALLLLLLLGSASSVGGNRCVDAAEACTADARCQRLRSEYVAQCLGRAAQGGCP
RARCRRALRRFFARGPPALTHALLFCPCAGPACAERRRQTFVPSCAFSGPGPAPPSCLEP
LNFCERSRVCRCARAAAGPWRGWGRGLSPAHRPPAAQASPPGLSGLVHPSAQRPRRLPAG
PGRPLPARLRGPRGVPAGTAVTPNYVDNVSARVAPWCDCGASGNRREDCEAFRGLFTRNR
CLDGAIQAFASGWPPVLLDQLNPQGDPEHSLLQVSSTGRALERRSLLSILPVLALPALL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggtccgctgcctggggcctgcgctgctgctgctgctgttactggggtcggcgagctcg
gtcggagggaaccgatgtgtggacgcggccgaagcctgcacggcggacgcgcggtgccag
cgtttgcgctccgagtatgtggcgcagtgcctgggccgggctgcgcaggggggctgtccc
cgcgcccgctgccgccgggccctgcgccgcttcttcgcccgcgggccgcccgcgctcacc
cacgcactgctcttctgcccgtgcgcgggccccgcgtgcgccgagcgtcggcgccagacc
ttcgtgccctcctgcgccttttcggggcccggccccgcgccgccctcctgccttgagccc
ttaaacttctgcgagcgcagccgggtctgcaggtgcgcgcgggcggcggcggggccgtgg
cgagggtggggacggggcctctctccggctcaccgccctcccgccgcgcaggcctcgcct
cctggcctttcaggtctcgtgcaccccagcgcccagcgcccccgacggctgcctgctgga
ccagggcgcccgctgcctgcgcgcctacgcgggcctcgtggggtccccgcaggcaccgcc
gtcacccctaactacgtggacaacgtgagcgcgcgcgtggcgccctggtgcgactgcgga
gccagcgggaaccggcgtgaggactgcgaagccttccgggggctctttaccaggaaccgc
tgcttggatggtgccattcaggcctttgccagcgggtggcccccagtcctgctggaccag
ctgaacccccagggagacccggagcacagcctcctgcaggtgtcctccacaggcagggcc
ctggagagacgctccctgctctccatacttcctgtcctggctctcccggccctgctctga

DBGET integrated database retrieval system