KEGG   Homo sapiens (human): 64098
Entry
64098             CDS       T01001                                 

Gene name
PARVG
Definition
(RefSeq) parvin gamma
  KO
K06275  parvin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    64098 (PARVG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    64098 (PARVG)
   04147 Exosome [BR:hsa04147]
    64098 (PARVG)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     64098 (PARVG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64098 (PARVG)
SSDB
Motif
Pfam: CH CAMSAP_CH
Other DBs
NCBI-GeneID: 64098
NCBI-ProteinID: NP_001131077
OMIM: 608122
HGNC: 14654
Ensembl: ENSG00000138964
Vega: OTTHUMG00000150473
Pharos: Q9HBI0(Tdark)
UniProt: Q9HBI0 A0A024R4U4
Position
22q13.31
AA seq 331 aa
MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLE
EWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLV
EQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNK
DAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
NT seq 996 nt   +upstreamnt  +downstreamnt
atggagccggagttcttgtacgacctgctgcagctccccaagggggtggagcccccagcg
gaggaggagctctcaaaaggaggaaagaagaaatacctgccacccacttcccggaaggac
cccaaatttgaagaactgcagaaggtgttgatggagtggatcaatgccactcttctcccc
gagcacattgtggtccgcagcctggaggaggacatgttcgacgggctcatcctacaccac
ctattccagaggctggcggcgctcaagctggaagcagaggacatcgccctgacagccaca
agccagaagcacaagctcacagtggtgctggaggccgtgaaccggagtctgcagctggag
gagtggcaggccaagtggagcgtggagagcatcttcaacaaggacctgttgtctaccctg
cacctccttgtggccctggccaagcgcttccagcccgacctctccctcccaaccaacgtc
caggtggaggtcatcactatcgagagcaccaaaagtggtctgaagtcagagaagttggtg
gaacagctcactgaatacagcacagacaaggacgagcctccaaaggacgtctttgatgaa
ttatttaagctggctccggagaaagtgaacgcagtgaaagaggccatcgtgaactttgtc
aaccagaagctggaccgcctgggcctgtctgtgcagaatctggacacccagtttgcagat
ggggtcatcttactcttgctgattggacaacttgaaggcttcttcctgcacttaaaggaa
ttctacctcactcccaactctcctgcagaaatgctgcacaacgtcaccctggcgctggag
ctgctgaaggacgagggcctgctcagctgccctgtcagccctgaagatatcgtgaacaag
gatgccaagagcacactgagggtgctctatggtctgttctgcaagcacacgcagaaggca
cacagggacaggacgccccatggagccccgaattga

DBGET integrated database retrieval system