KEGG   Homo sapiens (human): 64101
Entry
64101             CDS       T01001                                 

Symbol
LRRC4, NAG14, NGL-2
Name
(RefSeq) leucine rich repeat containing 4
  KO
K16351  netrin-G2 ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    64101 (LRRC4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    64101 (LRRC4)
SSDB
Motif
Pfam: LRR_8 LRR_5 LRR_4 I-set Ig_3 LRR_1 LRR_9 V-set ig LRRNT Ig_6 Ig_2 DAG1 Insulin_TMD
Other DBs
NCBI-GeneID: 64101
NCBI-ProteinID: NP_071426
OMIM: 610486
HGNC: 15586
Ensembl: ENSG00000128594
Vega: OTTHUMG00000157563
Pharos: Q9HBW1(Tbio)
UniProt: Q9HBW1
Structure
PDB: 
3ZYI 2DL9

Position
7q32.1
AA seq 653 aa
MKLLWQVTVHHHTWNAILLPFVYLTAQVWILCAAIAAAASAGPQNCPSVCSCSNQFSKVV
CTRRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFN
GLASLNTLELFDNWLTVIPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGE
LKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHG
LSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHN
PWNCDCDILWLAWWLREYIPTNSTCCGRCHAPMHMRGRYLVEVDQASFQCSAPFIMDAPR
DLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTG
VYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTS
TGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLDEVMKTTKIIIGCFVAVTLLA
AAMLIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPT
IHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgaagctcttgtggcaggtaactgtgcaccaccacacctggaatgccatcctgctcccg
ttcgtctacctcacggcgcaagtgtggattctgtgtgcagccatcgctgctgccgcctca
gccgggccccagaactgcccctccgtctgctcgtgcagtaaccagttcagcaaggtggtg
tgcacgcgccggggcctctccgaggtcccgcagggtattccctcgaacacccggtacctc
aacctcatggagaacaacatccagatgatccaggccgacaccttccgccacctccaccac
ctggaggtcctgcagttgggcaggaactccatccggcagattgaggtgggggccttcaac
ggcctggccagcctcaacaccctggagctgttcgacaactggctgacagtcatccctagc
ggggcctttgaatacctgtccaagctgcgggagctctggcttcgcaacaaccccatcgaa
agcatcccctcttacgccttcaaccgggtgccctccctcatgcgcctggacttgggggag
ctcaagaagctggagtatatctctgagggagcttttgaggggctgttcaacctcaagtat
ctgaacttgggcatgtgcaacattaaagacatgcccaatctcacccccctggtggggctg
gaggagctggagatgtcagggaaccacttccctgagatcaggcctggctccttccatggc
ctgagctccctcaagaagctctgggtcatgaactcacaggtcagcctgattgagcggaat
gcttttgacgggctggcttcacttgtggaactcaacttggcccacaataacctctcttct
ttgccccatgacctctttaccccgctgaggtacctggtggagttgcatctacaccacaac
ccttggaactgtgattgtgacattctgtggctagcctggtggcttcgagagtatataccc
accaattccacctgctgtggccgctgtcatgctcccatgcacatgcgaggccgctacctc
gtggaggtggaccaggcctccttccagtgctctgcccccttcatcatggacgcacctcga
gacctcaacatttctgagggtcggatggcagaacttaagtgtcggactccccctatgtcc
tccgtgaagtggttgctgcccaatgggacagtgctcagccacgcctcccgccacccaagg
atctctgtcctcaacgacggcaccttgaacttttcccacgtgctgctttcagacactggg
gtgtacacatgcatggtgaccaatgttgcaggcaactccaacgcctcggcctacctcaat
gtgagcacggctgagcttaacacctccaactacagcttcttcaccacagtaacagtggag
accacggagatctcgcctgaggacacaacgcgaaagtacaagcctgttcctaccacgtcc
actggttaccagccggcatataccacctctaccacggtgctcattcagactacccgtgtg
cccaagcaggtggcagtacccgcgacagacaccactgacaagatgcagaccagcctggat
gaagtcatgaagaccaccaagatcatcattggctgctttgtggcagtgactctgctagct
gccgccatgttgattgtcttctataaacttcgtaagcggcaccagcagcggagtacagtc
acagccgcccggactgttgagataatccaggtggacgaagacatcccagcagcaacatcc
gcagcagcaacagcagctccgtccggtgtatcaggtgagggggcagtagtgctgcccaca
attcatgaccatattaactacaacacctacaaaccagcacatggggcccactggacagaa
aacagcctggggaactctctgcaccccacagtcaccactatctctgaaccttatataatt
cagacccataccaaggacaaggtacaggaaactcaaatatga

DBGET integrated database retrieval system