KEGG   Homo sapiens (human): 64108Help
Entry
64108             CDS       T01001                                 

Gene name
RTP4, IFRG28, Z3CXXC4
Definition
(RefSeq) receptor transporter protein 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-3CxxC
Motif
Other DBs
NCBI-GeneID: 64108
NCBI-ProteinID: NP_071430
OMIM: 609350
HGNC: 23992
Ensembl: ENSG00000136514
Vega: OTTHUMG00000156459
Pharos: Q96DX8(Tbio)
UniProt: Q96DX8
Position
3q27.3
AA seq 246 aa AA seqDB search
MVVDFWTWEQTFQELIQEAKPRATWTLKLDGNLQLDCLAQGWKQYQQRAFGWFRCSSCQR
SWASAQVQILCHTYWEHWTSQGQVRMRLFGQRCQKCSWSQYEMPEFSSDSTMRILSNLVQ
HILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEACTLGICGQGLKSCMTKPSKSLLPH
LKTGNSSPGIGAVYLANQAKNQSAEAKEAKGSGYEKLGPSRDPDPLNICVFILLLVFIVV
KCFTSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggttgtagatttctggacttgggagcagacatttcaagaactaatccaagaggcaaaa
ccccgggccacatggacgctgaagttggatggcaaccttcagctagactgcctggctcaa
gggtggaagcaataccaacagagagcatttggctggttccggtgttcctcctgccagcga
agttgggcttccgcccaagtgcagattctgtgccacacgtactgggagcactggacatcc
cagggtcaggtgcgtatgaggctctttggccaaaggtgccagaagtgctcctggtcccaa
tatgagatgcctgagttctcctcggatagcaccatgaggattctgagcaacctggtgcag
catatactgaagaaatactatggaaatggcacgaggaagtctccagaaatgccagtaatc
ctggaagtgtccctggaaggatcccatgacacagccaattgtgaggcatgcactttgggc
atctgtggacagggcttaaaaagctgcatgacaaagccgtccaaatccctactcccccac
ctaaagactgggaattcctcacctggaattggtgctgtgtacctcgcaaaccaagccaag
aaccagtcagctgaggcaaaagaggctaaggggagtgggtatgagaaattagggcccagt
cgagacccagatccactgaacatctgtgtctttattttgctgcttgtatttattgtagtc
aaatgctttacatcagaatga

DBGET integrated database retrieval system