KEGG   Homo sapiens (human): 64130Help
Entry
64130             CDS       T01001                                 

Gene name
LIN7B, LIN-7B, MALS-2, MALS2, VELI2
Definition
(RefSeq) lin-7 homolog B, crumbs cell polarity complex component
  KO
K19931  protein lin-7
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    64130 (LIN7B)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    64130 (LIN7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDZ L27 PDZ_6 PDZ_2
Motif
Other DBs
NCBI-GeneID: 64130
NCBI-ProteinID: NP_071448
OMIM: 612331
HGNC: 17788
Ensembl: ENSG00000104863
Vega: OTTHUMG00000134288
Pharos: Q9HAP6(Tbio)
UniProt: Q9HAP6
Structure
PDB: 

Position
19q13.33
AA seq 207 aa AA seqDB search
MAALVEPLGLERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDT
LDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYIS
RVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEE
MEARFEKMRSARRRQQHQSYSSLESRG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgctggtggagccgctggggctggagcgggacgtgtcccgggcggttgagctc
ctcgagcggctccagcgcagcggggagctgccgccgcagaagctgcaggccctccagcga
gttctgcagagccgcttctgctccgctatccgagaggtgtatgagcagctttatgacacg
ctggacatcaccggcagcgccgagatccgagcccatgccacagccaaggccacagtggct
gccttcacagccagcgagggccacgcacatcccagggtagtggagctacccaagacggat
gagggcctaggcttcaacatcatgggtggcaaagagcaaaactcgcccatctacatctcc
cgggtcatcccagggggtgtggctgaccgccatggaggcctcaagcgtggggatcaactg
ttgtcggtgaacggtgtgagcgttgagggtgagcagcatgagaaggcggtggagctgctg
aaggcggcccagggctcggtgaagctggttgtccgttacacaccgcgagtgctggaggag
atggaggcccggttcgagaagatgcgctctgcccgccggcgccaacagcatcagagctac
tcgtccttggagtctcgaggttga

DBGET integrated database retrieval system