KEGG   Homo sapiens (human): 64146Help
Entry
64146             CDS       T01001                                 

Gene name
PDF
Definition
(RefSeq) peptide deformylase, mitochondrial
  KO
K01462  peptide deformylase [EC:3.5.1.88]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    64146 (PDF)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     64146 (PDF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pep_deformylase
Motif
Other DBs
NCBI-GeneID: 64146
NCBI-ProteinID: NP_071736
HGNC: 30012
Ensembl: ENSG00000258429
Vega: OTTHUMG00000171336
Pharos: Q9HBH1(Tchem)
UniProt: Q9HBH1 A0A024R6Y3
Structure
PDB: 

Position
16q22.1
AA seq 243 aa AA seqDB search
MARLWGALSLWPLWAAVPWGGAAAVGVRACSSTAAPDGVEGPALRRSYWRHLRRLVLGPP
EPPFSHVCQVGDPVLRGVAAPVERAQLGGPELQRLTQRLVQVMRRRRCVGLSAPQLGVPR
QVLALELPEALCRECPPRQRALRQMEPFPLRVFVNPSLRVLDSRLVTFPEGCESVAGFLA
CVPRFQAVQISGLDPNGEQVVWQASGWAARIIQHEMDHLQGCLFIDKMDSRTFTNVYWMK
VND
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctgtggggcgcgctgagtctttggccactgtgggcggccgtgccgtggggc
ggggcggcagccgtcggtgtccgggcttgcagctccacggccgccccggacggcgtcgag
ggcccggcgctgcggcgctcctattggcgccacctgaggcgtctggtgctgggtcctccc
gaaccgccgttctcgcacgtgtgccaagtcggggacccggtgctgcgcggcgtggcggcc
ccggtggagcgggcgcagctaggcgggcccgagctgcagcggctgacgcaacggctggtc
caggtgatgcggcggcggcgctgcgtgggcctaagcgcgccgcagctgggggtgccgcgg
caggtgctggcgctggagctccccgaggcgctgtgtcgggagtgcccgccccgccagcgc
gcgctccgccaaatggagcccttccccctgcgcgtgttcgtgaaccccagcctgcgagtg
cttgacagccgcctggtcacctttcccgagggctgcgagagcgtcgccggcttcctggcc
tgcgtgccccgcttccaggcggtgcagatctcagggctggaccccaatggagaacaggtg
gtgtggcaggcgagcgggtgggcagcccgcatcatccagcacgagatggaccacctgcag
ggctgcctgtttattgacaaaatggacagcaggacgttcacaaacgtctattggatgaag
gtgaatgactaa

DBGET integrated database retrieval system