KEGG   Homo sapiens (human): 64147Help
Entry
64147             CDS       T01001                                 

Gene name
KIF9
Definition
(RefSeq) kinesin family member 9
  KO
K10397  kinesin family member 6/9
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    64147 (KIF9)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     64147 (KIF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd AAA_22 AAA_30 Prismane AAA_7 ResIII Laminin_II
Motif
Other DBs
NCBI-GeneID: 64147
NCBI-ProteinID: NP_001128350
OMIM: 607910
HGNC: 16666
Ensembl: ENSG00000088727
Vega: OTTHUMG00000133512
Pharos: Q9HAQ2(Tbio)
UniProt: Q9HAQ2 A8K932
Structure
PDB: 

Position
3p21.31
AA seq 790 aa AA seqDB search
MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQTDWSFKLDGV
LHDASQDLVYETVAKDVVSQALDGYNGTIMCYGQTGAGKTYTMMGATENYKHRGILPRAL
QQVFRMIEERPTHAITVRVSYLEIYNESLFDLLSTLPYVGPSVTPMTIVENPQGVFIKGL
SVHLTSQEEDAFSLLFEGETNRIIASHTMNKNSSRSHCIFTIYLEAHSRTLSEEKYITSK
INLVDLAGSERLGKSGSEGQVLKEATYINKSLSFLEQAIIALGDQKRDHIPFRQCKLTHA
LKDSLGGNCNMVLVTNIYGEAAQLEETLSSLRFASRMKLVTTEPAINEKYDAERMVKNLE
KELALLKQELAIHDSLTNRTFVTYDPMDEIQIAEINSQVRRYLEGTLDEIDIISLRQIKE
VFNQFRVVLSQQEQEVESTLRRKYTLIDRNDFAAISAIQKAGLVDVDGHLVGEPEGQNFG
LGVAPFSTKPGKKAKSKKTFKEPLSSLARKEGASSPVNGKDLDYVSTSKTQLVPSSKDGD
VKDMLSRDRETSSIEPLPSDSPKEELRPIRPDTPPSKPVAFEEFKNEQGSEINRIFKENK
SILNERRKRASETTQHINAIKREIDVTKEALNFQKSLREKQGKYENKGLMIIDEEEFLLI
LKLKDLKKQYRSEYQDLRDLRAEIQYCQHLVDQCRHRLLMEFDIWYNESFVIPEDMQMAL
KPGGSIRPGMVPVNRIVSLGEDDQDKFSQLQQRVLPEGPDSISFYNAKVKIEQKHNYLKT
MMGLQQAHRK
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgggtactaggaaaaaagttcatgcatttgtccgtgtcaaacccaccgatgactttgct
catgaaatgatcagatacggagatgacaaaagaagcattgatattcacttaaaaaaagac
attcggagaggagttgtcaataaccaacagacagactggtcgtttaagttggatggagtt
cttcacgatgcctcccaggacttggtttatgagacagttgcaaaggatgtggtttctcag
gccctcgatggctataatggcaccatcatgtgttatgggcagacgggagctggcaagaca
tacaccatgatgggggcaactgagaattacaagcaccgggggatcctccctcgtgccctg
cagcaggtttttaggatgatcgaagaacgccccacacatgccatcactgtgcgtgtttcc
tacttggaaatctataatgagagcctgtttgatctcctgtccactctgccctatgttgga
ccctcagtcacaccaatgaccatcgtggaaaaccctcaaggagtcttcattaagggcttg
tcagttcacctcacaagtcaggaggaggatgcattcagcctcctttttgagggtgagacc
aacaggattatagcctcccacactatgaacaaaaactcttccagatcacactgcattttc
accatctacttagaggcccattcccggaccttatcagaggaaaagtacatcacttccaaa
attaacttggtggatctggcaggctcagagaggctggggaagtctgggtctgagggccaa
gtcctgaaggaagccacctacatcaacaaatcgctctcattcctggagcaggccatcatt
gcccttggggaccagaagcgggaccacatcccctttcggcagtgcaagctcacccacgct
ctgaaggactcgttagggggaaactgcaatatggtcctcgtgacaaacatctatggagaa
gctgcccagttagaagaaacgctatcttcactgagatttgccagcaggatgaagctagtc
accactgagcctgccatcaatgaaaagtatgatgctgagagaatggtcaagaacctggag
aaggaactagcactactcaagcaggagctggctatccatgacagcctgaccaaccgcacc
tttgtgacctatgaccccatggatgaaatccagattgctgagatcaactcccaggtgcgg
aggtacctggaggggacactggacgagatcgacataatcagccttagacagatcaaggag
gtgttcaaccagttccgggtggttctgagccaacaggaacaggaagtggagtccactttg
cgcaggaagtacaccctcattgacaggaatgactttgcagccatttctgctatccagaag
gcggggcttgtggatgttgatggccacctagtgggtgagcctgaaggacaaaactttgga
ctcggagtcgcccctttctctaccaaacctgggaagaaagccaagtccaagaagacattc
aaagagccactcagctccttggcaagaaaggaaggtgccagcagccctgtgaatgggaag
gacttggattacgtttccacctccaagacccagctggtcccatcctccaaagatggggat
gtcaaagacatgctttcgcgggaccgggaaacttccagcattgagccccttccctcagac
tccccgaaggaggaattacgcccaattaggcccgacaccccaccctccaaaccagtggcc
tttgaggagtttaagaatgagcaaggtagtgagatcaaccgaattttcaaagaaaacaaa
tccatcttgaatgaacggaggaaaagggccagcgagaccacacagcacatcaatgccatc
aagcgggagattgatgtgaccaaggaggccctgaatttccagaagtcactacgggagaag
caaggcaagtacgaaaacaaggggctgatgatcatcgatgaggaagaattcctgctgatc
ctcaagctcaaagacctcaagaagcagtaccgcagcgagtaccaggacctgcgtgacctc
agggctgagatccagtattgccagcacctagtggatcagtgtcgccaccgcctgctcatg
gaatttgacatctggtacaatgagtcctttgtcatccctgaggacatgcagatggcactg
aagccaggcggcagcatccggccaggcatggtccctgtgaacaggattgtgtctctggga
gaagatgaccaggacaaattcagccagctgcagcagagggtgcttcctgagggccctgat
tccatctccttctacaatgccaaagtcaagatagagcagaagcataattacttgaaaacc
atgatgggcctccagcaggcacatagaaaatag

DBGET integrated database retrieval system