KEGG   Homo sapiens (human): 6416Help
Entry
6416              CDS       T01001                                 

Gene name
MAP2K4, JNKK, JNKK1, MAPKK4, MEK4, MKK4, PRKMK4, SAPKK-1, SAPKK1, SEK1, SERK1, SKK1
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04912  GnRH signaling pathway
hsa04926  Relaxin signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00688  MAPK (JNK) signaling
Network
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00207  KSHV K15 to host-cell-protein activation
N00446  TNF-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6416 (MAP2K4)
   04012 ErbB signaling pathway
    6416 (MAP2K4)
   04668 TNF signaling pathway
    6416 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6416 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    6416 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6416 (MAP2K4)
   04926 Relaxin signaling pathway
    6416 (MAP2K4)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    6416 (MAP2K4)
  09167 Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6416 (MAP2K4)
   05166 HTLV-I infection
    6416 (MAP2K4)
   05164 Influenza A
    6416 (MAP2K4)
   05161 Hepatitis B
    6416 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6416 (MAP2K4)
   05169 Epstein-Barr virus infection
    6416 (MAP2K4)
   05142 Chagas disease (American trypanosomiasis)
    6416 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6416 (MAP2K4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     6416 (MAP2K4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE7 family
   6416 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 6416
NCBI-ProteinID: NP_003001
OMIM: 601335
HGNC: 6844
Ensembl: ENSG00000065559
Vega: OTTHUMG00000178267
Pharos: P45985(Tchem)
UniProt: P45985
Structure
PDB: 

Position
17p12
AA seq 399 aa AA seqDB search
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
cccggccccgtagggtccccggcgccaggccacccggccgtcagcagcatgcagggtaaa
cgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggtttact
ctgaatcccaatcctacaggagttcaaaacccacacatagagagactgagaacacacagc
attgagtcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagag
gacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtc
cacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaaaaa
gaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgcccatac
attgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaactc
atgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgttatt
ccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaa
gaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctggacagaagt
ggaaatattaagctctgtgacttcggcatcagtggacagcttgtggactctattgccaag
acaagagatgctggctgtaggccatacatggcacctgaaagaatagacccaagcgcatca
cgacaaggatatgatgtccgctctgatgtctggagtttggggatcacattgtatgagttg
gccacaggccgatttccttatccaaagtggaatagtgtatttgatcaactaacacaagtc
gtgaaaggagatcctccgcagctgagtaattctgaggaaagggaattctccccgagtttc
atcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagag
cttctgaaacatccctttattttgatgtatgaagaacgtgccgttgaggtcgcatgctat
gtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system