KEGG   Homo sapiens (human): 64168
Entry
64168             CDS       T01001                                 
Symbol
NECAB1, EFCBP1, STIP-1
Name
(RefSeq) N-terminal EF-hand calcium binding protein 1
  KO
K23854  N-terminal EF-hand calcium-binding protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    64168 (NECAB1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Calcium binding proteins
   64168 (NECAB1)
SSDB
Motif
Pfam: ABM EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 Rep_N PilM MRP-L28
Other DBs
NCBI-GeneID: 64168
NCBI-ProteinID: NP_071746
HGNC: 20983
Ensembl: ENSG00000123119
UniProt: Q8N987
Position
8:90791775..90959393
AA seq 351 aa
MEDSQETSPSSNNSSEELSSALHLSKGMSIFLDILRRADKNDDGKLSFEEFKAYFADGVL
SGEELHELFHTIDTHNTNNLDTEELCEYFSQHLGEYENVLAALEDLNLSILKAMGKTKKD
YQEASNLEQFVTRFLLKETLNQLQSLQNSLECAMETTEEQTRQERQGPAKPEVLSIQWPG
KRSSRRVQRHNSFSPNSPQFNVSGPGLLEEDNQWMTQINRLQKLIDRLEKKDLKLEPPEE
EIIEGNTKSHIMLVQRQMSVIEEDLEEFQLALKHYVESASSQSGCLRISIQKLSNESRYM
IYEFWENSSVWNSHLQTNYSKTFQRSNVDFLETPELTSTMLVPASWWILNN
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggaagattcccaggagacatcgccgtcctccaacaactcctcggaggagctcagctct
gctctgcacctgtccaagggcatgtcgatcttcctcgacatactgaggagagcagacaaa
aatgatgatggaaaattatcctttgaagaattcaaagcatattttgcagatggtgttctc
agtggagaagaattacacgagcttttccataccattgatacacataatactaataatctt
gacacagaagagctatgtgaatatttttctcagcacttgggcgagtatgagaatgtacta
gcagcacttgaagacctgaatctttccatcctgaaggcaatgggcaaaacaaagaaagac
taccaagaagcctccaatttggaacaattcgtaactagatttttattgaaggaaaccctg
aatcagctgcagtctctccagaattccctggaatgtgccatggaaactactgaggagcaa
acccgtcaagaaaggcaagggccagccaagccagaagtcctgtcgattcaatggcctgga
aaacgatcaagccgccgagtccagagacacaacagcttctccccaaacagccctcagttt
aatgtcagcggtccaggcttattagaagaagacaaccagtggatgacccagataaataga
ctccagaaattaattgatagactggaaaagaaggatctcaaactcgaaccaccagaagaa
gaaattattgaagggaatactaaatctcacatcatgcttgtgcagcggcagatgtctgtg
atagaagaggacctggaagaattccagctcgctctgaaacactacgtggagagtgcttcc
tcccaaagtggatgcttgcgtatttctatacagaagctttcaaatgaatctcgctacatg
atctatgagttctgggagaatagtagtgtatggaatagccaccttcagacaaattatagc
aagacattccaaagaagtaatgtggatttcttggaaactccagaactcacatctacaatg
ctagttcctgcttcgtggtggatcctgaacaactag

DBGET integrated database retrieval system