KEGG   Homo sapiens (human): 6418Help
Entry
6418              CDS       T01001                                 

Gene name
SET, 2PP2A, I2PP2A, IGAAD, IPP2A2, MRD58, PHAPII, TAF-I, TAF-IBETA
Definition
(RefSeq) SET nuclear proto-oncogene
  KO
K11290  template-activating factor I
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    6418 (SET)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histone chaperones
    NAPs (Nucleosome assembly proteins)
     6418 (SET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAP Phage_Mu_Gam Mst1_SARAH
Motif
Other DBs
NCBI-GeneID: 6418
NCBI-ProteinID: NP_001116293
OMIM: 600960
HGNC: 10760
Ensembl: ENSG00000119335
Vega: OTTHUMG00000020755
Pharos: Q01105(Tbio)
UniProt: Q01105 Q5VXV3
Structure
PDB: 

Position
9q34.11
AA seq 290 aa AA seqDB search
MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNE
QASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYL
TRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLT
KRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDD
EEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcccctaaacgccagtctccactcccgcctcaaaagaagaaaccaagaccacctcct
gctctgggaccggaggagacatcggcctctgcaggcttgccgaagaagggagaaaaagaa
cagcaagaagcgattgaacacattgatgaagtacaaaatgaaatagacagacttaatgaa
caagccagtgaggagattttgaaagtagaacagaaatataacaaactccgccaaccattt
tttcagaagaggtcagaattgatcgccaaaatcccaaatttttgggtaacaacatttgtc
aaccatccacaagtgtctgcactgcttggggaggaagatgaagaggcactgcattatttg
accagagttgaagtgacagaatttgaagatattaaatcaggttacagaatagatttttat
tttgatgaaaatccttactttgaaaataaagttctctccaaagaatttcatctgaatgag
agtggtgatccatcttcgaagtccaccgaaatcaaatggaaatctggaaaggatttgacg
aaacgttcgagtcaaacgcagaataaagccagcaggaagaggcagcatgaggaaccagag
agcttctttacctggtttactgaccattctgatgcaggtgctgatgagttaggagaggtc
atcaaagatgatatttggccaaacccattacagtactacttggttcccgatatggatgat
gaagaaggagaaggagaagaagatgatgatgatgatgaagaggaggaaggattagaagat
attgacgaagaaggggatgaggatgaaggtgaagaagatgaagatgatgatgaaggggag
gaaggagaggaggatgaaggagaagatgactaa

DBGET integrated database retrieval system